Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1063112..1063737 | Replicon | chromosome |
Accession | NZ_CP102679 | ||
Organism | Escherichia coli strain XH989 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NU949_RS07345 | Protein ID | WP_000911330.1 |
Coordinates | 1063339..1063737 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NU949_RS07340 | Protein ID | WP_000450524.1 |
Coordinates | 1063112..1063339 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU949_RS07315 (1058915) | 1058915..1059385 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NU949_RS07320 (1059385) | 1059385..1059957 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NU949_RS07325 (1060103) | 1060103..1060981 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NU949_RS07330 (1060998) | 1060998..1062032 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
NU949_RS07335 (1062245) | 1062245..1062958 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NU949_RS07340 (1063112) | 1063112..1063339 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NU949_RS07345 (1063339) | 1063339..1063737 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NU949_RS07350 (1063884) | 1063884..1064747 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NU949_RS07355 (1064762) | 1064762..1066777 | + | 2016 | WP_000829292.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NU949_RS07360 (1066851) | 1066851..1067549 | + | 699 | WP_000679812.1 | esterase | - |
NU949_RS07365 (1067630) | 1067630..1067830 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T253976 WP_000911330.1 NZ_CP102679:1063339-1063737 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|