Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 639565..640219 | Replicon | chromosome |
| Accession | NZ_CP102679 | ||
| Organism | Escherichia coli strain XH989 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | NU949_RS05330 | Protein ID | WP_000244772.1 |
| Coordinates | 639812..640219 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NU949_RS05325 | Protein ID | WP_000354046.1 |
| Coordinates | 639565..639831 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU949_RS05300 (634853) | 634853..635596 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| NU949_RS05305 (635653) | 635653..637086 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
| NU949_RS05310 (637131) | 637131..637442 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| NU949_RS05315 (637606) | 637606..638265 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NU949_RS05320 (638342) | 638342..639322 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| NU949_RS05325 (639565) | 639565..639831 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NU949_RS05330 (639812) | 639812..640219 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| NU949_RS05335 (640259) | 640259..640780 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NU949_RS05340 (640892) | 640892..641788 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NU949_RS05345 (641813) | 641813..642523 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NU949_RS05350 (642529) | 642529..644262 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T253974 WP_000244772.1 NZ_CP102679:639812-640219 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |