Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 9457..10049 Replicon plasmid pXH989-MCR
Accession NZ_CP102678
Organism Escherichia coli strain XH989

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag NU949_RS01745 Protein ID WP_000513532.1
Coordinates 9457..9705 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag NU949_RS01750 Protein ID WP_000681609.1
Coordinates 9702..10049 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU949_RS01710 (NU949_01710) 4469..5134 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
NU949_RS01715 (NU949_01715) 5723..6052 + 330 WP_001542022.1 hypothetical protein -
NU949_RS01720 (NU949_01720) 6453..6968 + 516 WP_001025393.1 J domain-containing protein -
NU949_RS01725 (NU949_01725) 7072..7614 + 543 WP_001083904.1 hypothetical protein -
NU949_RS01730 (NU949_01730) 7611..7865 + 255 WP_001230709.1 hypothetical protein -
NU949_RS01735 (NU949_01735) 7862..8104 + 243 WP_000151456.1 hypothetical protein -
NU949_RS01740 (NU949_01740) 8675..8968 + 294 WP_000673428.1 hypothetical protein -
NU949_RS01745 (NU949_01745) 9457..9705 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
NU949_RS01750 (NU949_01750) 9702..10049 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NU949_RS01755 (NU949_01755) 10137..10580 - 444 WP_023223351.1 hypothetical protein -
NU949_RS01760 (NU949_01760) 10821..11120 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
NU949_RS01765 (NU949_01765) 11380..11706 - 327 WP_000206697.1 hypothetical protein -
NU949_RS01770 (NU949_01770) 11708..12031 - 324 WP_223666488.1 hypothetical protein -
NU949_RS01775 (NU949_01775) 12008..12148 - 141 Protein_19 hypothetical protein -
NU949_RS01780 (NU949_01780) 12168..12875 - 708 WP_000108794.1 hypothetical protein -
NU949_RS01785 (NU949_01785) 12877..13629 - 753 WP_000797966.1 conjugal transfer protein TraL -
NU949_RS01790 (NU949_01790) 13647..14048 - 402 WP_021575837.1 hypothetical protein -
NU949_RS01795 (NU949_01795) 14416..14757 + 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62208 62208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T253970 WP_000513532.1 NZ_CP102678:9457-9705 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT253970 WP_000681609.1 NZ_CP102678:9702-10049 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References