253969

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 7611..8104 Replicon plasmid pXH989-MCR
Accession NZ_CP102678
Organism Escherichia coli strain XH989

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NU949_RS01730 Protein ID WP_001230709.1
Coordinates 7611..7865 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NU949_RS01735 Protein ID WP_000151456.1
Coordinates 7862..8104 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU949_RS01690 (NU949_01690) 3128..3280 + 153 Protein_2 FlmC family protein -
NU949_RS01695 (NU949_01695) 3228..3347 + 120 WP_229002406.1 Hok/Gef family protein -
NU949_RS01700 (NU949_01700) 3497..4093 + 597 WP_000125165.1 ProQ/FINO family protein -
NU949_RS01705 (NU949_01705) 4111..4395 - 285 WP_001162371.1 hypothetical protein -
NU949_RS01710 (NU949_01710) 4469..5134 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
NU949_RS01715 (NU949_01715) 5723..6052 + 330 WP_001542022.1 hypothetical protein -
NU949_RS01720 (NU949_01720) 6453..6968 + 516 WP_001025393.1 J domain-containing protein -
NU949_RS01725 (NU949_01725) 7072..7614 + 543 WP_001083904.1 hypothetical protein -
NU949_RS01730 (NU949_01730) 7611..7865 + 255 WP_001230709.1 hypothetical protein Toxin
NU949_RS01735 (NU949_01735) 7862..8104 + 243 WP_000151456.1 hypothetical protein Antitoxin
NU949_RS01740 (NU949_01740) 8675..8968 + 294 WP_000673428.1 hypothetical protein -
NU949_RS01745 (NU949_01745) 9457..9705 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
NU949_RS01750 (NU949_01750) 9702..10049 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
NU949_RS01755 (NU949_01755) 10137..10580 - 444 WP_023223351.1 hypothetical protein -
NU949_RS01760 (NU949_01760) 10821..11120 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
NU949_RS01765 (NU949_01765) 11380..11706 - 327 WP_000206697.1 hypothetical protein -
NU949_RS01770 (NU949_01770) 11708..12031 - 324 WP_223666488.1 hypothetical protein -
NU949_RS01775 (NU949_01775) 12008..12148 - 141 Protein_19 hypothetical protein -
NU949_RS01780 (NU949_01780) 12168..12875 - 708 WP_000108794.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62208 62208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T253969 WP_001230709.1 NZ_CP102678:7611-7865 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT253969 WP_000151456.1 NZ_CP102678:7862-8104 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References