Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 131439..132064 | Replicon | plasmid pXH989-CTX |
| Accession | NZ_CP102676 | ||
| Organism | Escherichia coli strain XH989 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NU949_RS00785 | Protein ID | WP_000911313.1 |
| Coordinates | 131666..132064 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | NU949_RS00780 | Protein ID | WP_000450520.1 |
| Coordinates | 131439..131666 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU949_RS00780 (131439) | 131439..131666 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NU949_RS00785 (131666) | 131666..132064 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NU949_RS00790 (132073) | 132073..134226 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
| NU949_RS00795 (134479) | 134479..135210 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| NU949_RS00800 (135242) | 135242..135739 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / rmtB / aac(3)-IId / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / fosA3 / blaCTX-M-65 / sitABCD | iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..188009 | 188009 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T253965 WP_000911313.1 NZ_CP102676:131666-132064 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|