Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4723987..4724822 | Replicon | chromosome |
| Accession | NZ_CP102675 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1U9SHU4 |
| Locus tag | NU950_RS24950 | Protein ID | WP_000854752.1 |
| Coordinates | 4723987..4724364 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | NU950_RS24955 | Protein ID | WP_001278232.1 |
| Coordinates | 4724454..4724822 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS24915 (4719507) | 4719507..4719980 | + | 474 | WP_001105384.1 | DNA gyrase inhibitor SbmC | - |
| NU950_RS24920 (4720178) | 4720178..4721236 | + | 1059 | WP_001200892.1 | FUSC family protein | - |
| NU950_RS24925 (4721408) | 4721408..4721737 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NU950_RS24930 (4721838) | 4721838..4722203 | - | 366 | WP_001282181.1 | EutP/PduV family microcompartment system protein | - |
| NU950_RS24935 (4722474) | 4722474..4722845 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| NU950_RS24940 (4723661) | 4723661..4723741 | - | 81 | Protein_4489 | hypothetical protein | - |
| NU950_RS24945 (4723841) | 4723841..4723990 | - | 150 | Protein_4490 | DUF5983 family protein | - |
| NU950_RS24950 (4723987) | 4723987..4724364 | - | 378 | WP_000854752.1 | TA system toxin CbtA family protein | Toxin |
| NU950_RS24955 (4724454) | 4724454..4724822 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NU950_RS24960 (4724985) | 4724985..4725206 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| NU950_RS24965 (4725269) | 4725269..4725745 | - | 477 | WP_001347688.1 | RadC family protein | - |
| NU950_RS24970 (4725761) | 4725761..4726246 | - | 486 | WP_000849582.1 | antirestriction protein | - |
| NU950_RS24975 (4726301) | 4726301..4727119 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| NU950_RS24980 (4727219) | 4727219..4727452 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| NU950_RS24985 (4727531) | 4727531..4727986 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14076.08 Da Isoelectric Point: 8.2905
>T253956 WP_000854752.1 NZ_CP102675:c4724364-4723987 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT253956 WP_001278232.1 NZ_CP102675:c4724822-4724454 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1U9SHU4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |