Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4158272..4158897 | Replicon | chromosome |
| Accession | NZ_CP102675 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NU950_RS22250 | Protein ID | WP_000911330.1 |
| Coordinates | 4158499..4158897 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NU950_RS22245 | Protein ID | WP_000450524.1 |
| Coordinates | 4158272..4158499 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS22220 (4154075) | 4154075..4154545 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NU950_RS22225 (4154545) | 4154545..4155117 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NU950_RS22230 (4155263) | 4155263..4156141 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NU950_RS22235 (4156158) | 4156158..4157192 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
| NU950_RS22240 (4157405) | 4157405..4158118 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NU950_RS22245 (4158272) | 4158272..4158499 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NU950_RS22250 (4158499) | 4158499..4158897 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NU950_RS22255 (4159044) | 4159044..4159907 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| NU950_RS22260 (4159922) | 4159922..4161937 | + | 2016 | WP_000829292.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NU950_RS22265 (4162011) | 4162011..4162709 | + | 699 | WP_000679812.1 | esterase | - |
| NU950_RS22270 (4162790) | 4162790..4162990 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T253954 WP_000911330.1 NZ_CP102675:4158499-4158897 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|