Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3585732..3586530 Replicon chromosome
Accession NZ_CP102675
Organism Escherichia coli strain XH987

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag NU950_RS19455 Protein ID WP_000854735.1
Coordinates 3585732..3586109 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag NU950_RS19460 Protein ID WP_032153712.1
Coordinates 3586156..3586530 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU950_RS19415 (3580948) 3580948..3581298 + 351 Protein_3410 general secretion pathway protein GspK -
NU950_RS19420 (3581295) 3581295..3582473 + 1179 WP_000094974.1 type II secretion system protein GspL -
NU950_RS19425 (3582475) 3582475..3583011 + 537 WP_000942795.1 GspM family type II secretion system protein YghD -
NU950_RS19430 (3583426) 3583426..3583752 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
NU950_RS19435 (3583749) 3583749..3584012 - 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
NU950_RS19440 (3584084) 3584084..3584950 - 867 WP_032153714.1 DUF4942 domain-containing protein -
NU950_RS19445 (3585035) 3585035..3585232 - 198 WP_000839265.1 DUF957 domain-containing protein -
NU950_RS19450 (3585244) 3585244..3585735 - 492 WP_023155722.1 DUF5983 family protein -
NU950_RS19455 (3585732) 3585732..3586109 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
NU950_RS19460 (3586156) 3586156..3586530 - 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NU950_RS19465 (3586610) 3586610..3586831 - 222 WP_000692345.1 DUF987 domain-containing protein -
NU950_RS19470 (3586900) 3586900..3587376 - 477 WP_001186715.1 RadC family protein -
NU950_RS19475 (3587392) 3587392..3587877 - 486 WP_032153711.1 antirestriction protein -
NU950_RS19480 (3587969) 3587969..3588787 - 819 WP_001234693.1 DUF932 domain-containing protein -
NU950_RS19485 (3588878) 3588878..3589087 - 210 WP_023155727.1 DUF905 family protein -
NU950_RS19490 (3589117) 3589117..3589794 - 678 WP_023155728.1 hypothetical protein -
NU950_RS19495 (3589913) 3589913..3590797 - 885 WP_024166630.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR papI / papB 3583749..3652185 68436


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T253951 WP_000854735.1 NZ_CP102675:c3586109-3585732 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT253951 WP_032153712.1 NZ_CP102675:c3586530-3586156 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References