Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3456875..3457716 | Replicon | chromosome |
| Accession | NZ_CP102675 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
| Locus tag | NU950_RS18805 | Protein ID | WP_000854822.1 |
| Coordinates | 3456875..3457258 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
| Locus tag | NU950_RS18810 | Protein ID | WP_053271974.1 |
| Coordinates | 3457348..3457716 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS18775 (3452521) | 3452521..3454362 | + | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
| NU950_RS18780 (3454440) | 3454440..3454946 | - | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| NU950_RS18790 (3455245) | 3455245..3456090 | - | 846 | WP_040234917.1 | DUF4942 domain-containing protein | - |
| NU950_RS18795 (3456187) | 3456187..3456384 | - | 198 | WP_000839263.1 | DUF957 domain-containing protein | - |
| NU950_RS18800 (3456396) | 3456396..3456884 | - | 489 | WP_001177592.1 | DUF5983 family protein | - |
| NU950_RS18805 (3456875) | 3456875..3457258 | - | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NU950_RS18810 (3457348) | 3457348..3457716 | - | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NU950_RS18815 (3457796) | 3457796..3458017 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| NU950_RS18820 (3458086) | 3458086..3458562 | - | 477 | WP_001186747.1 | RadC family protein | - |
| NU950_RS18825 (3458577) | 3458577..3459062 | - | 486 | WP_000214317.1 | antirestriction protein | - |
| NU950_RS18830 (3459153) | 3459153..3459971 | - | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
| NU950_RS18835 (3460298) | 3460298..3462055 | - | 1758 | Protein_3294 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | fosA3 | - | 3440698..3479264 | 38566 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T253950 WP_000854822.1 NZ_CP102675:c3457258-3456875 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT253950 WP_053271974.1 NZ_CP102675:c3457716-3457348 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0WJM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0CWL2 |