Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2100645..2101480 Replicon chromosome
Accession NZ_CP102675
Organism Escherichia coli strain XH987

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0J2AEA6
Locus tag NU950_RS12155 Protein ID WP_000854759.1
Coordinates 2100645..2101022 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NU950_RS12160 Protein ID WP_001295723.1
Coordinates 2101112..2101480 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU950_RS12130 (2097034) 2097034..2098575 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NU950_RS12135 (2099169) 2099169..2099345 - 177 Protein_2000 helix-turn-helix domain-containing protein -
NU950_RS12140 (2099712) 2099712..2099861 - 150 Protein_2001 hypothetical protein -
NU950_RS12145 (2099967) 2099967..2100143 - 177 WP_000839286.1 DUF957 domain-containing protein -
NU950_RS12150 (2100160) 2100160..2100648 - 489 WP_000761690.1 DUF5983 family protein -
NU950_RS12155 (2100645) 2100645..2101022 - 378 WP_000854759.1 TA system toxin CbtA family protein Toxin
NU950_RS12160 (2101112) 2101112..2101480 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NU950_RS12165 (2101643) 2101643..2101864 - 222 WP_000692345.1 DUF987 domain-containing protein -
NU950_RS12170 (2101927) 2101927..2102403 - 477 WP_001186775.1 RadC family protein -
NU950_RS12175 (2102419) 2102419..2102892 - 474 WP_000855059.1 antirestriction protein -
NU950_RS12180 (2103232) 2103232..2104050 - 819 WP_042631095.1 DUF932 domain-containing protein -
NU950_RS12185 (2104168) 2104168..2104363 - 196 Protein_2010 DUF905 family protein -
NU950_RS12190 (2104434) 2104434..2104652 - 219 WP_072649508.1 autotransporter domain-containing protein -
NU950_RS12195 (2104709) 2104709..2105731 + 1023 WP_000255946.1 IS21-like element IS100 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaCTX-M-55 cheD / fimH / fimG / fimF / fimD / fimC / fimI / fimA / fimE / fimB 1934407..2106111 171704
- flank IS/Tn - - 2097034..2098575 1541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14144.26 Da        Isoelectric Point: 7.3249

>T253944 WP_000854759.1 NZ_CP102675:c2101022-2100645 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT253944 WP_001295723.1 NZ_CP102675:c2101480-2101112 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2AEA6

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References