Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1401969..1402806 | Replicon | chromosome |
| Accession | NZ_CP102675 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | NU950_RS08745 | Protein ID | WP_000227784.1 |
| Coordinates | 1402264..1402806 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | NU950_RS08740 | Protein ID | WP_001297137.1 |
| Coordinates | 1401969..1402280 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS08715 (1396989) | 1396989..1397936 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| NU950_RS08720 (1397958) | 1397958..1399949 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| NU950_RS08725 (1399939) | 1399939..1400553 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| NU950_RS08730 (1400553) | 1400553..1400882 | + | 330 | WP_072649523.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| NU950_RS08735 (1400894) | 1400894..1401784 | + | 891 | WP_000971336.1 | heme o synthase | - |
| NU950_RS08740 (1401969) | 1401969..1402280 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| NU950_RS08745 (1402264) | 1402264..1402806 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| NU950_RS08750 (1402862) | 1402862..1403797 | - | 936 | WP_001365761.1 | tetratricopeptide repeat protein | - |
| NU950_RS08755 (1404205) | 1404205..1405569 | + | 1365 | WP_001000974.1 | MFS transporter | - |
| NU950_RS08760 (1405697) | 1405697..1406188 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| NU950_RS08765 (1406356) | 1406356..1407267 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T253941 WP_000227784.1 NZ_CP102675:1402264-1402806 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|