Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1367893..1368511 | Replicon | chromosome |
| Accession | NZ_CP102675 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NU950_RS08575 | Protein ID | WP_001291435.1 |
| Coordinates | 1368293..1368511 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NU950_RS08570 | Protein ID | WP_000344800.1 |
| Coordinates | 1367893..1368267 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS08560 (1362982) | 1362982..1364175 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NU950_RS08565 (1364198) | 1364198..1367347 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NU950_RS08570 (1367893) | 1367893..1368267 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NU950_RS08575 (1368293) | 1368293..1368511 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NU950_RS08580 (1368682) | 1368682..1369233 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NU950_RS08585 (1369349) | 1369349..1369819 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NU950_RS08590 (1369983) | 1369983..1371533 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NU950_RS08595 (1371575) | 1371575..1371928 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
| NU950_RS08605 (1372307) | 1372307..1372618 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NU950_RS08610 (1372649) | 1372649..1373221 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253940 WP_001291435.1 NZ_CP102675:1368293-1368511 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253940 WP_000344800.1 NZ_CP102675:1367893-1368267 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |