Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 381202..381840 | Replicon | chromosome |
Accession | NZ_CP102675 | ||
Organism | Escherichia coli strain XH987 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NU950_RS03810 | Protein ID | WP_000813794.1 |
Coordinates | 381664..381840 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NU950_RS03805 | Protein ID | WP_001270286.1 |
Coordinates | 381202..381618 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU950_RS03785 (376354) | 376354..377295 | - | 942 | WP_072649490.1 | ABC transporter permease | - |
NU950_RS03790 (377296) | 377296..378309 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NU950_RS03795 (378327) | 378327..379472 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
NU950_RS03800 (379717) | 379717..381123 | - | 1407 | WP_000760592.1 | PLP-dependent aminotransferase family protein | - |
NU950_RS03805 (381202) | 381202..381618 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NU950_RS03810 (381664) | 381664..381840 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NU950_RS03815 (382062) | 382062..382292 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NU950_RS03820 (382384) | 382384..384345 | - | 1962 | WP_001593323.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NU950_RS03825 (384418) | 384418..384954 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NU950_RS03830 (385046) | 385046..386221 | + | 1176 | WP_001236215.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T253939 WP_000813794.1 NZ_CP102675:c381840-381664 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT253939 WP_001270286.1 NZ_CP102675:c381618-381202 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|