Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 32726..33327 | Replicon | plasmid pXH987-OQX |
| Accession | NZ_CP102674 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | NU950_RS01580 | Protein ID | WP_001216034.1 |
| Coordinates | 32947..33327 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NU950_RS01575 | Protein ID | WP_001190712.1 |
| Coordinates | 32726..32947 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS01550 (NU950_01550) | 27970..29232 | + | 1263 | WP_024245586.1 | hypothetical protein | - |
| NU950_RS01555 (NU950_01555) | 29305..29811 | + | 507 | WP_024245587.1 | hypothetical protein | - |
| NU950_RS01560 (NU950_01560) | 29989..30336 | + | 348 | WP_228252666.1 | hypothetical protein | - |
| NU950_RS01565 (NU950_01565) | 30333..30695 | + | 363 | WP_001261543.1 | hypothetical protein | - |
| NU950_RS01570 (NU950_01570) | 32264..32653 | + | 390 | WP_000506730.1 | S24 family peptidase | - |
| NU950_RS01575 (NU950_01575) | 32726..32947 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NU950_RS01580 (NU950_01580) | 32947..33327 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NU950_RS01585 (NU950_01585) | 33332..33511 | + | 180 | WP_000113018.1 | hypothetical protein | - |
| NU950_RS01590 (NU950_01590) | 33539..34582 | + | 1044 | WP_063090816.1 | DUF968 domain-containing protein | - |
| NU950_RS01595 (NU950_01595) | 34671..35123 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
| NU950_RS01600 (NU950_01600) | 35209..36402 | + | 1194 | WP_029487616.1 | hypothetical protein | - |
| NU950_RS01605 (NU950_01605) | 36402..37886 | + | 1485 | WP_042016904.1 | terminase | - |
| NU950_RS01610 (NU950_01610) | 38109..38228 | + | 120 | WP_071527722.1 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | oqxA / oqxB | - | 1..100243 | 100243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T253937 WP_001216034.1 NZ_CP102674:32947-33327 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |