Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 32726..33327 Replicon plasmid pXH987-OQX
Accession NZ_CP102674
Organism Escherichia coli strain XH987

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NU950_RS01580 Protein ID WP_001216034.1
Coordinates 32947..33327 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NU950_RS01575 Protein ID WP_001190712.1
Coordinates 32726..32947 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU950_RS01550 (NU950_01550) 27970..29232 + 1263 WP_024245586.1 hypothetical protein -
NU950_RS01555 (NU950_01555) 29305..29811 + 507 WP_024245587.1 hypothetical protein -
NU950_RS01560 (NU950_01560) 29989..30336 + 348 WP_228252666.1 hypothetical protein -
NU950_RS01565 (NU950_01565) 30333..30695 + 363 WP_001261543.1 hypothetical protein -
NU950_RS01570 (NU950_01570) 32264..32653 + 390 WP_000506730.1 S24 family peptidase -
NU950_RS01575 (NU950_01575) 32726..32947 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NU950_RS01580 (NU950_01580) 32947..33327 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NU950_RS01585 (NU950_01585) 33332..33511 + 180 WP_000113018.1 hypothetical protein -
NU950_RS01590 (NU950_01590) 33539..34582 + 1044 WP_063090816.1 DUF968 domain-containing protein -
NU950_RS01595 (NU950_01595) 34671..35123 + 453 WP_001326849.1 late promoter-activating protein -
NU950_RS01600 (NU950_01600) 35209..36402 + 1194 WP_029487616.1 hypothetical protein -
NU950_RS01605 (NU950_01605) 36402..37886 + 1485 WP_042016904.1 terminase -
NU950_RS01610 (NU950_01610) 38109..38228 + 120 WP_071527722.1 ash family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid oqxA / oqxB - 1..100243 100243


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T253937 WP_001216034.1 NZ_CP102674:32947-33327 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT253937 WP_001190712.1 NZ_CP102674:32726-32947 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References