Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 90909..91534 | Replicon | plasmid pXH987-CTX |
Accession | NZ_CP102673 | ||
Organism | Escherichia coli strain XH987 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NU950_RS00900 | Protein ID | WP_000911313.1 |
Coordinates | 90909..91307 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | NU950_RS00905 | Protein ID | WP_000450520.1 |
Coordinates | 91307..91534 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU950_RS00885 (87234) | 87234..87731 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
NU950_RS00890 (87763) | 87763..88494 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
NU950_RS00895 (88747) | 88747..90900 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
NU950_RS00900 (90909) | 90909..91307 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NU950_RS00905 (91307) | 91307..91534 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / sitABCD / blaCTX-M-65 / fosA3 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId | iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA | 1..167177 | 167177 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T253933 WP_000911313.1 NZ_CP102673:c91307-90909 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|