253929

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 34795..35288 Replicon plasmid pXH987-MCR
Accession NZ_CP102672
Organism Escherichia coli strain XH987

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NU950_RS00185 Protein ID WP_001230709.1
Coordinates 35034..35288 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NU950_RS00180 Protein ID WP_000151456.1
Coordinates 34795..35037 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU950_RS00135 (NU950_00135) 30024..30731 + 708 WP_000108794.1 hypothetical protein -
NU950_RS00140 (NU950_00140) 30751..30891 + 141 Protein_27 hypothetical protein -
NU950_RS00145 (NU950_00145) 30868..31191 + 324 WP_223666488.1 hypothetical protein -
NU950_RS00150 (NU950_00150) 31193..31519 + 327 WP_000206697.1 hypothetical protein -
NU950_RS00155 (NU950_00155) 31779..32078 - 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
NU950_RS00160 (NU950_00160) 32319..32762 + 444 WP_023223351.1 hypothetical protein -
NU950_RS00165 (NU950_00165) 32850..33197 - 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
NU950_RS00170 (NU950_00170) 33194..33442 - 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
NU950_RS00175 (NU950_00175) 33931..34224 - 294 WP_000673428.1 hypothetical protein -
NU950_RS00180 (NU950_00180) 34795..35037 - 243 WP_000151456.1 hypothetical protein Antitoxin
NU950_RS00185 (NU950_00185) 35034..35288 - 255 WP_001230709.1 hypothetical protein Toxin
NU950_RS00190 (NU950_00190) 35285..35827 - 543 WP_001083904.1 hypothetical protein -
NU950_RS00195 (NU950_00195) 35931..36446 - 516 WP_001025393.1 J domain-containing protein -
NU950_RS00200 (NU950_00200) 36847..37176 - 330 WP_001542022.1 hypothetical protein -
NU950_RS00205 (NU950_00205) 37765..38430 + 666 WP_000532149.1 division plane positioning ATPase MipZ -
NU950_RS00210 (NU950_00210) 38504..38788 + 285 WP_001162371.1 hypothetical protein -
NU950_RS00215 (NU950_00215) 38806..39402 - 597 WP_000125165.1 ProQ/FINO family protein -
NU950_RS00220 (NU950_00220) 39552..39671 - 120 WP_229002406.1 Hok/Gef family protein -
NU950_RS00225 (NU950_00225) 39619..39771 - 153 Protein_44 FlmC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62280 62280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T253929 WP_001230709.1 NZ_CP102672:c35288-35034 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT253929 WP_000151456.1 NZ_CP102672:c35037-34795 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References