Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 32850..33442 Replicon plasmid pXH987-MCR
Accession NZ_CP102672
Organism Escherichia coli strain XH987

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag NU950_RS00170 Protein ID WP_000513532.1
Coordinates 33194..33442 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag NU950_RS00165 Protein ID WP_000681609.1
Coordinates 32850..33197 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU950_RS00120 (NU950_00120) 28142..28483 - 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -
NU950_RS00125 (NU950_00125) 28851..29252 + 402 WP_021575837.1 hypothetical protein -
NU950_RS00130 (NU950_00130) 29270..30022 + 753 WP_000797966.1 conjugal transfer protein TraL -
NU950_RS00135 (NU950_00135) 30024..30731 + 708 WP_000108794.1 hypothetical protein -
NU950_RS00140 (NU950_00140) 30751..30891 + 141 Protein_27 hypothetical protein -
NU950_RS00145 (NU950_00145) 30868..31191 + 324 WP_223666488.1 hypothetical protein -
NU950_RS00150 (NU950_00150) 31193..31519 + 327 WP_000206697.1 hypothetical protein -
NU950_RS00155 (NU950_00155) 31779..32078 - 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
NU950_RS00160 (NU950_00160) 32319..32762 + 444 WP_023223351.1 hypothetical protein -
NU950_RS00165 (NU950_00165) 32850..33197 - 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NU950_RS00170 (NU950_00170) 33194..33442 - 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
NU950_RS00175 (NU950_00175) 33931..34224 - 294 WP_000673428.1 hypothetical protein -
NU950_RS00180 (NU950_00180) 34795..35037 - 243 WP_000151456.1 hypothetical protein -
NU950_RS00185 (NU950_00185) 35034..35288 - 255 WP_001230709.1 hypothetical protein -
NU950_RS00190 (NU950_00190) 35285..35827 - 543 WP_001083904.1 hypothetical protein -
NU950_RS00195 (NU950_00195) 35931..36446 - 516 WP_001025393.1 J domain-containing protein -
NU950_RS00200 (NU950_00200) 36847..37176 - 330 WP_001542022.1 hypothetical protein -
NU950_RS00205 (NU950_00205) 37765..38430 + 666 WP_000532149.1 division plane positioning ATPase MipZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62280 62280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T253928 WP_000513532.1 NZ_CP102672:c33442-33194 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT253928 WP_000681609.1 NZ_CP102672:c33197-32850 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References