Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 89247..89772 Replicon plasmid unnamed
Accession NZ_CP102670
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag NUW86_RS24850 Protein ID WP_001159863.1
Coordinates 89467..89772 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag NUW86_RS24845 Protein ID WP_000813641.1
Coordinates 89247..89465 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUW86_RS24815 (NUW86_24815) 84534..84915 + 382 Protein_100 YgiW/YdeI family stress tolerance OB fold protein -
NUW86_RS24820 (NUW86_24820) 85084..85528 + 445 Protein_101 tyrosine-type recombinase/integrase -
NUW86_RS24825 (NUW86_24825) 85787..86776 - 990 WP_001527061.1 RepB family plasmid replication initiator protein -
NUW86_RS24830 (NUW86_24830) 87270..87566 - 297 WP_001687482.1 hypothetical protein -
NUW86_RS24835 (NUW86_24835) 87578..88006 + 429 Protein_104 hypothetical protein -
NUW86_RS24840 (NUW86_24840) 88050..88571 - 522 WP_010999942.1 hypothetical protein -
NUW86_RS24845 (NUW86_24845) 89247..89465 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NUW86_RS24850 (NUW86_24850) 89467..89772 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
NUW86_RS24855 (NUW86_24855) 89774..90064 + 291 WP_001266176.1 hypothetical protein -
NUW86_RS24860 (NUW86_24860) 90061..90582 + 522 WP_000198608.1 hypothetical protein -
NUW86_RS24865 (NUW86_24865) 90617..91399 + 783 WP_000082169.1 site-specific integrase -
NUW86_RS24870 (NUW86_24870) 91408..91959 + 552 WP_000545754.1 EAL domain-containing protein -
NUW86_RS24875 (NUW86_24875) 92146..92634 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
NUW86_RS24880 (NUW86_24880) 92628..93113 + 486 WP_000905606.1 membrane protein -
NUW86_RS24885 (NUW86_24885) 93390..93677 - 288 WP_071530243.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - fdeC / spvC / spvB / rck / pefD / pefC / pefA / pefB 1..93832 93832


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T253927 WP_001159863.1 NZ_CP102670:89467-89772 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT253927 WP_000813641.1 NZ_CP102670:89247-89465 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References