Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 61788..62413 | Replicon | plasmid unnamed |
Accession | NZ_CP102670 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUW86_RS24690 | Protein ID | WP_000911322.1 |
Coordinates | 61788..62186 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NUW86_RS24695 | Protein ID | WP_000450265.1 |
Coordinates | 62186..62413 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUW86_RS24675 (NUW86_24675) | 57979..58473 | + | 495 | WP_010999946.1 | entry exclusion protein | - |
NUW86_RS24680 (NUW86_24680) | 58509..59240 | + | 732 | WP_000782438.1 | conjugal transfer complement resistance protein TraT | - |
NUW86_RS24685 (NUW86_24685) | 59617..61779 | + | 2163 | WP_000009318.1 | type IV conjugative transfer system coupling protein TraD | - |
NUW86_RS24690 (NUW86_24690) | 61788..62186 | - | 399 | WP_000911322.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUW86_RS24695 (NUW86_24695) | 62186..62413 | - | 228 | WP_000450265.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | fdeC / spvC / spvB / rck / pefD / pefC / pefA / pefB | 1..93832 | 93832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14887.13 Da Isoelectric Point: 8.5264
>T253926 WP_000911322.1 NZ_CP102670:c62186-61788 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|