Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3620183..3620803 | Replicon | chromosome |
Accession | NZ_CP102669 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NUW86_RS18095 | Protein ID | WP_001280991.1 |
Coordinates | 3620585..3620803 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NUW86_RS18090 | Protein ID | WP_000344807.1 |
Coordinates | 3620183..3620557 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUW86_RS18080 (3615322) | 3615322..3616515 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NUW86_RS18085 (3616538) | 3616538..3619687 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NUW86_RS18090 (3620183) | 3620183..3620557 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NUW86_RS18095 (3620585) | 3620585..3620803 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NUW86_RS18100 (3620982) | 3620982..3621533 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NUW86_RS18105 (3621650) | 3621650..3622120 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NUW86_RS18110 (3622176) | 3622176..3622316 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NUW86_RS18115 (3622322) | 3622322..3622582 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NUW86_RS18120 (3622807) | 3622807..3624357 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NUW86_RS18130 (3624588) | 3624588..3624977 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NUW86_RS18135 (3625010) | 3625010..3625579 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T253918 WP_001280991.1 NZ_CP102669:3620585-3620803 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT253918 WP_000344807.1 NZ_CP102669:3620183-3620557 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|