Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-parD/RHH(antitoxin) |
Location | 940516..941062 | Replicon | chromosome |
Accession | NZ_CP102665 | ||
Organism | Sphingobium sp. JS3065 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NUH86_RS21660 | Protein ID | WP_267252543.1 |
Coordinates | 940516..940809 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NUH86_RS21665 | Protein ID | WP_267252544.1 |
Coordinates | 940802..941062 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUH86_RS21650 (NUH86_21655) | 937184..937606 | - | 423 | WP_267252541.1 | Imm63 family immunity protein | - |
NUH86_RS21655 (NUH86_21660) | 937939..939978 | - | 2040 | WP_267252542.1 | TonB-dependent receptor | - |
NUH86_RS21660 (NUH86_21665) | 940516..940809 | - | 294 | WP_267252543.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUH86_RS21665 (NUH86_21670) | 940802..941062 | - | 261 | WP_267252544.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NUH86_RS21670 (NUH86_21675) | 941278..941808 | + | 531 | WP_267252545.1 | GNAT family N-acetyltransferase | - |
NUH86_RS21675 (NUH86_21680) | 941850..942446 | - | 597 | WP_267252546.1 | alpha/beta hydrolase | - |
NUH86_RS21680 (NUH86_21685) | 943131..943961 | + | 831 | WP_267252547.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
NUH86_RS21685 (NUH86_21690) | 944134..944454 | + | 321 | WP_084438946.1 | hypothetical protein | - |
NUH86_RS21690 (NUH86_21695) | 944658..945146 | + | 489 | WP_267252548.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11034.58 Da Isoelectric Point: 4.2184
>T253905 WP_267252543.1 NZ_CP102665:c940809-940516 [Sphingobium sp. JS3065]
MAEIIISQQADDDFERIWLNIALDNDDAADRLLRAINVKIERLRIFPEIGRARDDLSPGARGLVHGSYLILYEYDAARDV
VTIVTVVEGMRDLDCLF
MAEIIISQQADDDFERIWLNIALDNDDAADRLLRAINVKIERLRIFPEIGRARDDLSPGARGLVHGSYLILYEYDAARDV
VTIVTVVEGMRDLDCLF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|