Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 327649..328307 | Replicon | chromosome |
Accession | NZ_CP102665 | ||
Organism | Sphingobium sp. JS3065 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUH86_RS18900 | Protein ID | WP_267252858.1 |
Coordinates | 327870..328307 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1H7CAD6 |
Locus tag | NUH86_RS18895 | Protein ID | WP_066860643.1 |
Coordinates | 327649..327873 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUH86_RS18865 (NUH86_18870) | 322734..322934 | - | 201 | WP_267252852.1 | hypothetical protein | - |
NUH86_RS18870 (NUH86_18875) | 323650..323925 | + | 276 | WP_267252853.1 | HU family DNA-binding protein | - |
NUH86_RS18875 (NUH86_18880) | 324591..325349 | + | 759 | WP_267252854.1 | LuxR family transcriptional regulator | - |
NUH86_RS18880 (NUH86_18885) | 325633..326247 | + | 615 | WP_267252855.1 | acyl-homoserine-lactone synthase | - |
NUH86_RS18885 (NUH86_18890) | 326260..327165 | + | 906 | WP_267252856.1 | phytanoyl-CoA dioxygenase family protein | - |
NUH86_RS18890 (NUH86_18895) | 327182..327580 | + | 399 | WP_267252857.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NUH86_RS18895 (NUH86_18900) | 327649..327873 | + | 225 | WP_066860643.1 | CopG family transcriptional regulator | Antitoxin |
NUH86_RS18900 (NUH86_18905) | 327870..328307 | + | 438 | WP_267252858.1 | PIN domain-containing protein | Toxin |
NUH86_RS18905 (NUH86_18910) | 328307..329227 | + | 921 | WP_267252998.1 | nucleotidyltransferase domain-containing protein | - |
NUH86_RS18910 (NUH86_18915) | 329604..330416 | + | 813 | WP_267252859.1 | DNA-binding response regulator | - |
NUH86_RS18915 (NUH86_18920) | 330409..330996 | + | 588 | WP_267252860.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 221345..462026 | 240681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15707.84 Da Isoelectric Point: 6.6936
>T253904 WP_267252858.1 NZ_CP102665:327870-328307 [Sphingobium sp. JS3065]
VTYLLDVNVLVALIDPNHVGHDAAHHWFESIGARAWATCPITENGVIRIVGNVKYPSTPGSPAEVARIIGQMRQLPGHSF
WADDISLLSDERVDESRLLTSAQVTDTYLLALAVAHDGKLATFDRRLSPRAVSGGKAALHLIGHQ
VTYLLDVNVLVALIDPNHVGHDAAHHWFESIGARAWATCPITENGVIRIVGNVKYPSTPGSPAEVARIIGQMRQLPGHSF
WADDISLLSDERVDESRLLTSAQVTDTYLLALAVAHDGKLATFDRRLSPRAVSGGKAALHLIGHQ
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|