Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 201604..202163 | Replicon | chromosome |
Accession | NZ_CP102665 | ||
Organism | Sphingobium sp. JS3065 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NUH86_RS18405 | Protein ID | WP_267252773.1 |
Coordinates | 201870..202163 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NUH86_RS18400 | Protein ID | WP_267252772.1 |
Coordinates | 201604..201873 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUH86_RS18370 (NUH86_18375) | 196973..197527 | - | 555 | WP_267252766.1 | hypothetical protein | - |
NUH86_RS18375 (NUH86_18380) | 197572..197739 | + | 168 | WP_267252767.1 | hypothetical protein | - |
NUH86_RS18380 (NUH86_18385) | 197905..199428 | + | 1524 | WP_267252768.1 | IS21 family transposase | - |
NUH86_RS18385 (NUH86_18390) | 199418..200200 | + | 783 | WP_267252769.1 | IS21-like element helper ATPase IstB | - |
NUH86_RS18390 (NUH86_18395) | 200262..200840 | - | 579 | WP_267252770.1 | hypothetical protein | - |
NUH86_RS18395 (NUH86_18400) | 200907..201224 | - | 318 | WP_267252771.1 | hypothetical protein | - |
NUH86_RS18400 (NUH86_18405) | 201604..201873 | + | 270 | WP_267252772.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NUH86_RS18405 (NUH86_18410) | 201870..202163 | + | 294 | WP_267252773.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUH86_RS18410 (NUH86_18415) | 202207..202377 | - | 171 | WP_267252774.1 | hypothetical protein | - |
NUH86_RS18415 (NUH86_18420) | 202422..204326 | - | 1905 | WP_267252775.1 | plasmid recombination protein | - |
NUH86_RS18420 (NUH86_18425) | 204557..205045 | - | 489 | WP_267252776.1 | hypothetical protein | - |
NUH86_RS18425 (NUH86_18430) | 205967..206617 | + | 651 | WP_267252777.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 201328..221284 | 19956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11449.15 Da Isoelectric Point: 9.0138
>T253903 WP_267252773.1 NZ_CP102665:201870-202163 [Sphingobium sp. JS3065]
MKIQWTSKASSDLLRLHEHLRPVAPEAAARVVQQLAHAPNRLLDYPRLGEKLEAFEPREVRRIIVGNYEMRYEIASGTIF
ILRLWHCRENRSFESEH
MKIQWTSKASSDLLRLHEHLRPVAPEAAARVVQQLAHAPNRLLDYPRLGEKLEAFEPREVRRIIVGNYEMRYEIASGTIF
ILRLWHCRENRSFESEH
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|