Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3192538..3193199 | Replicon | chromosome |
Accession | NZ_CP102664 | ||
Organism | Sphingobium sp. JS3065 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUH86_RS15570 | Protein ID | WP_267252163.1 |
Coordinates | 3192810..3193199 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NUH86_RS15565 | Protein ID | WP_267250326.1 |
Coordinates | 3192538..3192801 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUH86_RS15540 (NUH86_15545) | 3189053..3189451 | + | 399 | WP_267252202.1 | hypothetical protein | - |
NUH86_RS15545 (NUH86_15550) | 3189542..3189970 | - | 429 | Protein_3057 | DNA polymerase Y family protein | - |
NUH86_RS15550 (NUH86_15555) | 3190197..3190976 | - | 780 | WP_267250323.1 | protein ImuA | - |
NUH86_RS15555 (NUH86_15560) | 3191078..3191500 | - | 423 | WP_267250324.1 | DUF1810 domain-containing protein | - |
NUH86_RS15560 (NUH86_15565) | 3191500..3192117 | - | 618 | WP_267250325.1 | SOS response-associated peptidase | - |
NUH86_RS15565 (NUH86_15570) | 3192538..3192801 | + | 264 | WP_267250326.1 | antitoxin | Antitoxin |
NUH86_RS15570 (NUH86_15575) | 3192810..3193199 | + | 390 | WP_267252163.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUH86_RS15575 (NUH86_15580) | 3193430..3194014 | + | 585 | WP_267250327.1 | SOS response-associated peptidase family protein | - |
NUH86_RS15580 (NUH86_15585) | 3194035..3194610 | + | 576 | WP_267252164.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
NUH86_RS15585 (NUH86_15590) | 3194724..3194918 | + | 195 | WP_267250328.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NUH86_RS15590 (NUH86_15595) | 3194966..3196498 | + | 1533 | WP_267250329.1 | Fic family protein | - |
NUH86_RS15595 (NUH86_15600) | 3196662..3198032 | + | 1371 | WP_013039223.1 | IS1380-like element ISSp1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3196662..3198032 | 1370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13642.58 Da Isoelectric Point: 5.5791
>T253902 WP_267252163.1 NZ_CP102664:3192810-3193199 [Sphingobium sp. JS3065]
MLDTNIVSDLLRHPDGSAAKRIAEVGPDAICVSIITAAELRYGCARKGSAKLLAHVEAILESVQVLALDVPADAEYGGIR
AEHEAAGKPIGPNDLFIAAHAYAAGAILVTNNTGEFSRIRGLQVENWIR
MLDTNIVSDLLRHPDGSAAKRIAEVGPDAICVSIITAAELRYGCARKGSAKLLAHVEAILESVQVLALDVPADAEYGGIR
AEHEAAGKPIGPNDLFIAAHAYAAGAILVTNNTGEFSRIRGLQVENWIR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|