Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1681874..1682673 | Replicon | chromosome |
| Accession | NZ_CP102664 | ||
| Organism | Sphingobium sp. JS3065 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NUH86_RS08030 | Protein ID | WP_267251930.1 |
| Coordinates | 1682170..1682673 (+) | Length | 168 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | N1MNI2 |
| Locus tag | NUH86_RS08025 | Protein ID | WP_006960007.1 |
| Coordinates | 1681874..1682161 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUH86_RS08015 (NUH86_08015) | 1677406..1681149 | + | 3744 | WP_267251928.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| NUH86_RS08020 (NUH86_08020) | 1681146..1681679 | - | 534 | WP_267251929.1 | hypothetical protein | - |
| NUH86_RS08025 (NUH86_08025) | 1681874..1682161 | + | 288 | WP_006960007.1 | DUF1778 domain-containing protein | Antitoxin |
| NUH86_RS08030 (NUH86_08030) | 1682170..1682673 | + | 504 | WP_267251930.1 | GNAT family N-acetyltransferase | Toxin |
| NUH86_RS08035 (NUH86_08035) | 1682700..1683614 | + | 915 | WP_267251931.1 | HEPN domain-containing protein | - |
| NUH86_RS08040 (NUH86_08040) | 1683718..1686705 | + | 2988 | WP_267251932.1 | RelA/SpoT domain-containing protein | - |
| NUH86_RS08045 (NUH86_08045) | 1686738..1687313 | - | 576 | WP_267251933.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 168 a.a. Molecular weight: 18448.02 Da Isoelectric Point: 8.9296
>T253901 WP_267251930.1 NZ_CP102664:1682170-1682673 [Sphingobium sp. JS3065]
MAPQFRIEKLRRDHAIDVFDCGREELNRFLSRYAWQAQQGGASQSYVALTGDEVVGFHTLVVGHVDHSDAPDRLTKGMAR
HPVPLMILARLGVSTGYQGKGLGSGLLKDALTRTLQAADIAGIRAIAAHAKDEAARQFYQNFDFIPGLSDPNHMFLLLKD
ARRHLQG
MAPQFRIEKLRRDHAIDVFDCGREELNRFLSRYAWQAQQGGASQSYVALTGDEVVGFHTLVVGHVDHSDAPDRLTKGMAR
HPVPLMILARLGVSTGYQGKGLGSGLLKDALTRTLQAADIAGIRAIAAHAKDEAARQFYQNFDFIPGLSDPNHMFLLLKD
ARRHLQG
Download Length: 504 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|