Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 889159..889696 | Replicon | chromosome |
| Accession | NZ_CP102664 | ||
| Organism | Sphingobium sp. JS3065 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NUH86_RS04345 | Protein ID | WP_013846902.1 |
| Coordinates | 889159..889455 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | NUH86_RS04350 | Protein ID | WP_013846901.1 |
| Coordinates | 889445..889696 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUH86_RS04345 (NUH86_04345) | 889159..889455 | - | 297 | WP_013846902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUH86_RS04350 (NUH86_04350) | 889445..889696 | - | 252 | WP_013846901.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| NUH86_RS04355 (NUH86_04355) | 889923..890399 | + | 477 | WP_013846900.1 | hypothetical protein | - |
| NUH86_RS04360 (NUH86_04360) | 890396..890701 | + | 306 | WP_013846899.1 | hypothetical protein | - |
| NUH86_RS04365 (NUH86_04365) | 890889..892136 | + | 1248 | WP_013846898.1 | hypothetical protein | - |
| NUH86_RS04370 (NUH86_04370) | 892303..893112 | + | 810 | WP_013846897.1 | type I restriction-modification system subunit M | - |
| NUH86_RS04375 (NUH86_04375) | 893254..893949 | + | 696 | WP_013846896.1 | hypothetical protein | - |
| NUH86_RS04380 (NUH86_04380) | 894025..894672 | + | 648 | WP_013846895.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10941.43 Da Isoelectric Point: 6.8785
>T253900 WP_013846902.1 NZ_CP102664:c889455-889159 [Sphingobium sp. JS3065]
MAYRLTRNAEKDLIGIYVGGVGELGEAVAEKYQAGLHRVFGFLSDFPYSARARAEISPPVRAHPYKSHIVVYIIEGQDIL
ILGVRHGREDWQASDQLS
MAYRLTRNAEKDLIGIYVGGVGELGEAVAEKYQAGLHRVFGFLSDFPYSARARAEISPPVRAHPYKSHIVVYIIEGQDIL
ILGVRHGREDWQASDQLS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|