Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 129221..129794 Replicon chromosome
Accession NZ_CP102664
Organism Sphingobium sp. JS3065

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NUH86_RS00615 Protein ID WP_267250783.1
Coordinates 129636..129794 (-) Length 53 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NUH86_RS00610 Protein ID WP_267250782.1
Coordinates 129221..129616 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUH86_RS00580 (NUH86_00580) 124996..125736 + 741 WP_267250776.1 ComF family protein -
NUH86_RS00585 (NUH86_00585) 125781..126038 + 258 WP_267250777.1 glutaredoxin 3 -
NUH86_RS00590 (NUH86_00590) 126044..126874 + 831 WP_267250778.1 carbon-nitrogen hydrolase family protein -
NUH86_RS00595 (NUH86_00595) 126871..127353 + 483 WP_267250779.1 DUF1178 family protein -
NUH86_RS00600 (NUH86_00600) 127468..127896 - 429 WP_267250780.1 site-specific integrase -
NUH86_RS00605 (NUH86_00605) 128063..129091 - 1029 WP_267250781.1 glycosyltransferase -
NUH86_RS00610 (NUH86_00610) 129221..129616 - 396 WP_267250782.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NUH86_RS00615 (NUH86_00615) 129636..129794 - 159 WP_267250783.1 type II toxin-antitoxin system HicA family toxin Toxin
NUH86_RS00620 (NUH86_00620) 129877..130902 - 1026 WP_267250784.1 contractile injection system protein, VgrG/Pvc8 family -
NUH86_RS00625 (NUH86_00625) 130899..131018 - 120 WP_267250785.1 phage tail protein -
NUH86_RS00635 (NUH86_00635) 132186..132461 - 276 WP_267252189.1 phage head closure protein -
NUH86_RS00640 (NUH86_00640) 132634..133209 - 576 WP_267250786.1 hypothetical protein -
NUH86_RS00645 (NUH86_00645) 133246..133704 - 459 WP_267250787.1 cupin domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 126871..132344 5473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(1-51)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-123)


Sequences

Toxin        


Download         Length: 53 a.a.        Molecular weight: 5764.89 Da        Isoelectric Point: 11.4350

>T253899 WP_267250783.1 NZ_CP102664:c129794-129636 [Sphingobium sp. JS3065]
VKRLADEGFELVSVKGSHHKFRKGGRMIIVPHPKKDLPLGTARSIAKMAGWL

Download         Length: 159 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14468.41 Da        Isoelectric Point: 4.3536

>AT253899 WP_267250782.1 NZ_CP102664:c129616-129221 [Sphingobium sp. JS3065]
MMKYFYAIVHKDPDSAYGVTFPDLPGCFSAADREEEVLPNAVEALDLWFEDADDVQPRPIDQIRAAVADELAQGAYLLAV
PRISAAGKITRVNLSMDRGMLDAIDDAAALRKLTRSAFMIEAARNEIEGRH

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References