Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1439965..1440884 | Replicon | chromosome |
Accession | NZ_CP102663 | ||
Organism | Bacillus sp. BAC |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | T5HIF3 |
Locus tag | NR984_RS07420 | Protein ID | WP_003180879.1 |
Coordinates | 1440138..1440884 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | T5HT37 |
Locus tag | NR984_RS07415 | Protein ID | WP_003180877.1 |
Coordinates | 1439965..1440138 (-) | Length | 58 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR984_RS07390 (NR984_07390) | 1435390..1436487 | + | 1098 | WP_003180867.1 | mannonate dehydratase | - |
NR984_RS07395 (NR984_07395) | 1436463..1437311 | + | 849 | WP_003180869.1 | SDR family oxidoreductase | - |
NR984_RS07400 (NR984_07400) | 1437338..1438351 | + | 1014 | WP_011197810.1 | zinc-binding alcohol dehydrogenase family protein | - |
NR984_RS07405 (NR984_07405) | 1438404..1439675 | + | 1272 | WP_011197811.1 | MFS transporter | - |
NR984_RS07410 (NR984_07410) | 1439738..1439869 | - | 132 | WP_003180875.1 | hypothetical protein | - |
NR984_RS07415 (NR984_07415) | 1439965..1440138 | - | 174 | WP_003180877.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NR984_RS07420 (NR984_07420) | 1440138..1440884 | - | 747 | WP_003180879.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NR984_RS07425 (NR984_07425) | 1440995..1441993 | - | 999 | WP_009328723.1 | inorganic phosphate transporter | - |
NR984_RS07430 (NR984_07430) | 1442006..1442623 | - | 618 | WP_003180884.1 | DUF47 domain-containing protein | - |
NR984_RS07435 (NR984_07435) | 1442955..1444712 | + | 1758 | WP_003180886.1 | gamma-glutamyltransferase | - |
NR984_RS07440 (NR984_07440) | 1444841..1445485 | + | 645 | WP_009328721.1 | YesL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29391.80 Da Isoelectric Point: 4.5367
>T253898 WP_003180879.1 NZ_CP102663:c1440884-1440138 [Bacillus sp. BAC]
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|