Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 564709..565345 Replicon chromosome
Accession NZ_CP102663
Organism Bacillus sp. BAC

Toxin (Protein)


Gene name mazF Uniprot ID M5P3Q9
Locus tag NR984_RS02825 Protein ID WP_003179128.1
Coordinates 564995..565345 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID M5PDU2
Locus tag NR984_RS02820 Protein ID WP_006638778.1
Coordinates 564709..564990 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR984_RS02800 (NR984_02800) 559824..561305 + 1482 WP_009330132.1 PH domain-containing protein -
NR984_RS02805 (NR984_02805) 561302..561901 - 600 WP_003179118.1 rhomboid family intramembrane serine protease -
NR984_RS02810 (NR984_02810) 562244..563203 + 960 WP_152847888.1 outer membrane lipoprotein carrier protein LolA -
NR984_RS02815 (NR984_02815) 563428..564597 + 1170 WP_025805944.1 alanine racemase -
NR984_RS02820 (NR984_02820) 564709..564990 + 282 WP_006638778.1 hypothetical protein Antitoxin
NR984_RS02825 (NR984_02825) 564995..565345 + 351 WP_003179128.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
NR984_RS02830 (NR984_02830) 565463..566290 + 828 WP_003179130.1 RsbT co-antagonist protein RsbRA -
NR984_RS02835 (NR984_02835) 566294..566659 + 366 WP_003179132.1 STAS domain-containing protein -
NR984_RS02840 (NR984_02840) 566662..567063 + 402 WP_003179135.1 anti-sigma regulatory factor -
NR984_RS02845 (NR984_02845) 567074..568081 + 1008 WP_003179137.1 PP2C family protein-serine/threonine phosphatase -
NR984_RS02850 (NR984_02850) 568140..568466 + 327 WP_003179140.1 anti-sigma factor antagonist -
NR984_RS02855 (NR984_02855) 568466..568951 + 486 WP_003179142.1 anti-sigma B factor RsbW -
NR984_RS02860 (NR984_02860) 568917..569708 + 792 WP_003179144.1 RNA polymerase sigma factor SigB -
NR984_RS02865 (NR984_02865) 569705..570304 + 600 WP_003179145.1 PP2C family serine/threonine-protein phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12990.03 Da        Isoelectric Point: 5.7234

>T253897 WP_003179128.1 NZ_CP102663:564995-565345 [Bacillus sp. BAC]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10649.03 Da        Isoelectric Point: 4.6920

>AT253897 WP_006638778.1 NZ_CP102663:564709-564990 [Bacillus sp. BAC]
MSESSATTEILIRLPEALVSELDGVVMQDNGSRNELIYQATKMYLRERKNRQIRESMRRGYMEMAKINLNISSEAQFAEY
EAENTVERLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6I7FHI4

Antitoxin

Source ID Structure
AlphaFold DB M5PDU2

References