Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 63725..64218 Replicon plasmid unnamed
Accession NZ_CP102628
Organism Listeria innocua strain F4078

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NVV61_RS14235 Protein ID WP_068995950.1
Coordinates 63943..64218 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NVV61_RS14230 Protein ID WP_068995951.1
Coordinates 63725..63946 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NVV61_RS14185 (NVV61_14185) 58771..58983 + 213 WP_068995955.1 hypothetical protein -
NVV61_RS14190 (NVV61_14190) 58976..59511 + 536 Protein_60 helix-turn-helix domain-containing protein -
NVV61_RS14195 (NVV61_14195) 59502..59705 + 204 WP_258210442.1 hypothetical protein -
NVV61_RS14200 (NVV61_14200) 59827..60432 + 606 WP_077316131.1 helix-turn-helix transcriptional regulator -
NVV61_RS14205 (NVV61_14205) 60576..60920 + 345 WP_002375364.1 PadR family transcriptional regulator -
NVV61_RS14210 (NVV61_14210) 60910..61566 + 657 WP_258210443.1 DUF1129 domain-containing protein -
NVV61_RS14215 (NVV61_14215) 61836..62422 + 587 Protein_65 recombinase family protein -
NVV61_RS14220 (NVV61_14220) 62403..62729 + 327 WP_068995953.1 hypothetical protein -
NVV61_RS14225 (NVV61_14225) 62810..63490 + 681 WP_176714219.1 IS6 family transposase -
NVV61_RS14230 (NVV61_14230) 63725..63946 + 222 WP_068995951.1 DUF6290 family protein Antitoxin
NVV61_RS14235 (NVV61_14235) 63943..64218 + 276 WP_068995950.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NVV61_RS14240 (NVV61_14240) 64228..64419 + 192 WP_226325631.1 hypothetical protein -
NVV61_RS14245 (NVV61_14245) 64453..66357 + 1905 WP_070232215.1 hypothetical protein -
NVV61_RS14250 (NVV61_14250) 66373..66645 + 273 WP_068995947.1 DUF5592 family protein -
NVV61_RS14255 (NVV61_14255) 66647..67186 + 540 WP_077316130.1 hypothetical protein -
NVV61_RS14260 (NVV61_14260) 67183..69141 + 1959 WP_187983845.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..104605 104605
- flank IS/Tn - - 62810..63490 680


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-89)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10882.57 Da        Isoelectric Point: 10.4614

>T253896 WP_068995950.1 NZ_CP102628:63943-64218 [Listeria innocua]
MSKHFHVRFEKDAQKVLKKMDRFQAKLILSWIEKHIEGSDNPRQHGKSLVGNRVGQWRYRVGDYRLIAEIQDNEVIVLIL
NIGHRRDIYDK

Download         Length: 276 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8509.66 Da        Isoelectric Point: 4.4929

>AT253896 WP_068995951.1 NZ_CP102628:63725-63946 [Listeria innocua]
MTTITFRVSEQEKAFIQEMAKFNGISISELSRKQIIEGLEDQIDLQSYERAIKAHQVKDESISFDEMKKELDL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References