Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 660700..661329 | Replicon | chromosome |
Accession | NZ_CP102626 | ||
Organism | Listeria innocua strain 2012L-5520 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | Q92DC7 |
Locus tag | MXK52_RS03290 | Protein ID | WP_010990666.1 |
Coordinates | 660982..661329 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7U7S1X0 |
Locus tag | MXK52_RS03285 | Protein ID | WP_003766128.1 |
Coordinates | 660700..660978 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MXK52_RS03265 (MXK52_03265) | 655997..657481 | + | 1485 | WP_003766120.1 | PH domain-containing protein | - |
MXK52_RS03270 (MXK52_03270) | 657632..659011 | + | 1380 | WP_003766122.1 | protoporphyrinogen oxidase | - |
MXK52_RS03275 (MXK52_03275) | 659013..659369 | + | 357 | WP_003766124.1 | holo-ACP synthase | - |
MXK52_RS03280 (MXK52_03280) | 659388..660494 | + | 1107 | WP_003766126.1 | alanine racemase | - |
MXK52_RS03285 (MXK52_03285) | 660700..660978 | + | 279 | WP_003766128.1 | CopG family ribbon-helix-helix protein | Antitoxin |
MXK52_RS03290 (MXK52_03290) | 660982..661329 | + | 348 | WP_010990666.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MXK52_RS03295 (MXK52_03295) | 661579..662415 | + | 837 | WP_003766130.1 | RsbT co-antagonist protein RsbRA | - |
MXK52_RS03300 (MXK52_03300) | 662421..662777 | + | 357 | WP_003721457.1 | STAS domain-containing protein | - |
MXK52_RS03305 (MXK52_03305) | 662780..663190 | + | 411 | WP_031649219.1 | anti-sigma regulatory factor | - |
MXK52_RS03310 (MXK52_03310) | 663207..664211 | + | 1005 | WP_003761312.1 | PP2C family protein-serine/threonine phosphatase | - |
MXK52_RS03315 (MXK52_03315) | 664361..664705 | + | 345 | WP_003721460.1 | anti sigma b factor antagonist RsbV | - |
MXK52_RS03320 (MXK52_03320) | 664689..665162 | + | 474 | WP_003761314.1 | anti-sigma B factor RsbW | - |
MXK52_RS03325 (MXK52_03325) | 665140..665919 | + | 780 | WP_003761316.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12801.85 Da Isoelectric Point: 6.4735
>T253894 WP_010990666.1 NZ_CP102626:660982-661329 [Listeria innocua]
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMAKVNQALEVSLGVVEF
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMAKVNQALEVSLGVVEF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1E7E4N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U7S1X0 |