Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 939015..939662 | Replicon | chromosome |
| Accession | NZ_CP102606 | ||
| Organism | Thermus sp. PS18 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | E8PLT6 |
| Locus tag | KQ693_RS05310 | Protein ID | WP_015716453.1 |
| Coordinates | 939015..939401 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | E8PLT7 |
| Locus tag | KQ693_RS05315 | Protein ID | WP_015716454.1 |
| Coordinates | 939402..939662 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KQ693_RS05275 (KQ693_05275) | 934047..935120 | + | 1074 | WP_015716446.1 | radical SAM protein | - |
| KQ693_RS05280 (KQ693_05280) | 935157..935546 | + | 390 | WP_019551701.1 | NADH-quinone oxidoreductase subunit 15 | - |
| KQ693_RS05285 (KQ693_05285) | 935543..935941 | - | 399 | WP_015716448.1 | PaaI family thioesterase | - |
| KQ693_RS05290 (KQ693_05290) | 935972..937093 | - | 1122 | WP_267262146.1 | radical SAM family heme chaperone HemW | - |
| KQ693_RS05295 (KQ693_05295) | 937094..937486 | - | 393 | WP_019551703.1 | HEPN domain-containing protein | - |
| KQ693_RS05300 (KQ693_05300) | 937476..937793 | - | 318 | WP_019551704.1 | nucleotidyltransferase domain-containing protein | - |
| KQ693_RS05305 (KQ693_05305) | 937798..939018 | - | 1221 | WP_267262147.1 | glycerate kinase | - |
| KQ693_RS05310 (KQ693_05310) | 939015..939401 | - | 387 | WP_015716453.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| KQ693_RS05315 (KQ693_05315) | 939402..939662 | - | 261 | WP_015716454.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| KQ693_RS05320 (KQ693_05320) | 939670..940956 | - | 1287 | WP_015716455.1 | glycolate oxidase subunit GlcF | - |
| KQ693_RS05325 (KQ693_05325) | 940961..942007 | - | 1047 | WP_015716456.1 | FAD-binding protein | - |
| KQ693_RS05330 (KQ693_05330) | 942000..943403 | - | 1404 | WP_267262148.1 | FAD-linked oxidase C-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14014.22 Da Isoelectric Point: 5.6564
>T253893 WP_015716453.1 NZ_CP102606:c939401-939015 [Thermus sp. PS18]
MVLDTSAVLAILLREPGYETLLQRIVRGEPPKIGAPTLAEAGIVVVARLGFSYLHLLYELLEALGAEVIPFTEKHAREAI
RAYKEFGRAQHPAGLNFGDCLSYATARVEGMPLLYKGDDFAQTDLGQK
MVLDTSAVLAILLREPGYETLLQRIVRGEPPKIGAPTLAEAGIVVVARLGFSYLHLLYELLEALGAEVIPFTEKHAREAI
RAYKEFGRAQHPAGLNFGDCLSYATARVEGMPLLYKGDDFAQTDLGQK
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|