Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2574065..2574681 | Replicon | chromosome |
| Accession | NZ_CP102604 | ||
| Organism | Pantoea sp. SOD02 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NR302_RS12025 | Protein ID | WP_258143556.1 |
| Coordinates | 2574493..2574681 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NR302_RS12020 | Protein ID | WP_258143555.1 |
| Coordinates | 2574065..2574475 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR302_RS12000 (NR302_12000) | 2569992..2570819 | - | 828 | WP_179450225.1 | MetQ/NlpA family lipoprotein | - |
| NR302_RS12005 (NR302_12005) | 2571033..2571674 | + | 642 | WP_258143553.1 | TetR family transcriptional regulator | - |
| NR302_RS12010 (NR302_12010) | 2571749..2573131 | + | 1383 | WP_258143554.1 | D-arabinono-1,4-lactone oxidase | - |
| NR302_RS12015 (NR302_12015) | 2573150..2573977 | + | 828 | WP_061717669.1 | glycosyltransferase family 8 protein | - |
| NR302_RS12020 (NR302_12020) | 2574065..2574475 | - | 411 | WP_258143555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NR302_RS12025 (NR302_12025) | 2574493..2574681 | - | 189 | WP_258143556.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NR302_RS12030 (NR302_12030) | 2574826..2575146 | - | 321 | WP_008110563.1 | PTS system regulator TmaR | - |
| NR302_RS12035 (NR302_12035) | 2575308..2576366 | - | 1059 | WP_008110562.1 | FUSC family protein | - |
| NR302_RS12040 (NR302_12040) | 2576729..2577193 | - | 465 | WP_258143557.1 | GyrI-like domain-containing protein | - |
| NR302_RS12045 (NR302_12045) | 2577282..2578448 | - | 1167 | WP_258143558.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6970.23 Da Isoelectric Point: 11.0007
>T253890 WP_258143556.1 NZ_CP102604:c2574681-2574493 [Pantoea sp. SOD02]
MDSRSLMAEIKADGWELIRVNGSHHHFVHPVKKGLVTIPHPKKDLPVKTVKSIRKQAGLTVH
MDSRSLMAEIKADGWELIRVNGSHHHFVHPVKKGLVTIPHPKKDLPVKTVKSIRKQAGLTVH
Download Length: 189 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14785.11 Da Isoelectric Point: 4.5951
>AT253890 WP_258143555.1 NZ_CP102604:c2574475-2574065 [Pantoea sp. SOD02]
MFYPIAIEAGDQSTAFGVTVPDLPGCFSAGDTLEAAVKNAKEAIIGHLELLVELEQDIPAVSELKSLMKDPQYAGYVWVL
IDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTS
MFYPIAIEAGDQSTAFGVTVPDLPGCFSAGDTLEAAVKNAKEAIIGHLELLVELEQDIPAVSELKSLMKDPQYAGYVWVL
IDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTS
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|