Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1698478..1699096 | Replicon | chromosome |
Accession | NZ_CP102604 | ||
Organism | Pantoea sp. SOD02 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NR302_RS07895 | Protein ID | WP_036649445.1 |
Coordinates | 1698914..1699096 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NR302_RS07890 | Protein ID | WP_154152625.1 |
Coordinates | 1698478..1698873 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR302_RS07870 (NR302_07870) | 1694271..1695683 | - | 1413 | WP_258144947.1 | hypothetical protein | - |
NR302_RS07875 (NR302_07875) | 1695676..1696590 | - | 915 | WP_154152634.1 | glycosyltransferase family 2 protein | - |
NR302_RS07880 (NR302_07880) | 1696598..1696945 | - | 348 | Protein_1527 | GtrA family protein | - |
NR302_RS07885 (NR302_07885) | 1697122..1698378 | - | 1257 | WP_061716806.1 | mechanosensitive ion channel | - |
NR302_RS07890 (NR302_07890) | 1698478..1698873 | - | 396 | WP_154152625.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NR302_RS07895 (NR302_07895) | 1698914..1699096 | - | 183 | WP_036649445.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NR302_RS07900 (NR302_07900) | 1699367..1699564 | + | 198 | WP_008108184.1 | DUF6404 family protein | - |
NR302_RS07905 (NR302_07905) | 1699666..1699860 | + | 195 | WP_258144948.1 | hypothetical protein | - |
NR302_RS07910 (NR302_07910) | 1699889..1700137 | - | 249 | WP_007891510.1 | CsbD family protein | - |
NR302_RS07915 (NR302_07915) | 1700286..1700837 | - | 552 | WP_258144949.1 | hypothetical protein | - |
NR302_RS07920 (NR302_07920) | 1700899..1701228 | - | 330 | WP_008108186.1 | hypothetical protein | - |
NR302_RS07925 (NR302_07925) | 1701428..1701607 | + | 180 | WP_008108187.1 | hypothetical protein | - |
NR302_RS07930 (NR302_07930) | 1701737..1702120 | + | 384 | WP_008108188.1 | hypothetical protein | - |
NR302_RS07935 (NR302_07935) | 1702122..1702796 | - | 675 | WP_008108190.1 | MBL fold metallo-hydrolase | - |
NR302_RS07940 (NR302_07940) | 1702820..1703743 | - | 924 | WP_258144950.1 | muramoyltetrapeptide carboxypeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6932.18 Da Isoelectric Point: 10.6249
>T253889 WP_036649445.1 NZ_CP102604:c1699096-1698914 [Pantoea sp. SOD02]
MKSSELIKMLVNTGWSLERIKGSHHQFSHPDFSYLITVPHPRKDLKTGTLMQILKDAKLK
MKSSELIKMLVNTGWSLERIKGSHHQFSHPDFSYLITVPHPRKDLKTGTLMQILKDAKLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14681.49 Da Isoelectric Point: 4.4315
>AT253889 WP_154152625.1 NZ_CP102604:c1698873-1698478 [Pantoea sp. SOD02]
MLYPAFVEIDVDGSASGFFPDVTGCYFAGDTPEHTLYDAQSALSAHFELMAEKSMLIPEPSQNWITDFSQTGIWIYVEID
ITRYLGKSERINITMPNLLIEKIDQAVGNDARYNSRSHFLAEAARKALSHS
MLYPAFVEIDVDGSASGFFPDVTGCYFAGDTPEHTLYDAQSALSAHFELMAEKSMLIPEPSQNWITDFSQTGIWIYVEID
ITRYLGKSERINITMPNLLIEKIDQAVGNDARYNSRSHFLAEAARKALSHS
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|