Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1130802..1131422 | Replicon | chromosome |
| Accession | NZ_CP102604 | ||
| Organism | Pantoea sp. SOD02 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | J2UI73 |
| Locus tag | NR302_RS05145 | Protein ID | WP_007886938.1 |
| Coordinates | 1130802..1131020 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J3DFW0 |
| Locus tag | NR302_RS05150 | Protein ID | WP_007886936.1 |
| Coordinates | 1131045..1131422 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR302_RS05115 (NR302_05115) | 1126582..1126920 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
| NR302_RS05120 (NR302_05120) | 1126954..1128243 | + | 1290 | WP_008103907.1 | ammonium transporter AmtB | - |
| NR302_RS05125 (NR302_05125) | 1128315..1129178 | - | 864 | WP_258144712.1 | acyl-CoA thioesterase II | - |
| NR302_RS05130 (NR302_05130) | 1129384..1129941 | + | 558 | WP_008103903.1 | YbaY family lipoprotein | - |
| NR302_RS05135 (NR302_05135) | 1130087..1130398 | - | 312 | WP_008103902.1 | MGMT family protein | - |
| NR302_RS05145 (NR302_05145) | 1130802..1131020 | - | 219 | WP_007886938.1 | HHA domain-containing protein | Toxin |
| NR302_RS05150 (NR302_05150) | 1131045..1131422 | - | 378 | WP_007886936.1 | Hha toxicity modulator TomB | Antitoxin |
| NR302_RS05155 (NR302_05155) | 1131570..1131923 | - | 354 | WP_154153581.1 | hypothetical protein | - |
| NR302_RS05160 (NR302_05160) | 1132264..1132920 | + | 657 | WP_258144713.1 | ABC transporter ATP-binding protein | - |
| NR302_RS05165 (NR302_05165) | 1132917..1133756 | + | 840 | WP_258144714.1 | metal ABC transporter permease | - |
| NR302_RS05170 (NR302_05170) | 1133779..1134657 | + | 879 | WP_258144715.1 | metal ABC transporter substrate-binding protein | - |
| NR302_RS05175 (NR302_05175) | 1134702..1134842 | - | 141 | WP_008103894.1 | type B 50S ribosomal protein L36 | - |
| NR302_RS05180 (NR302_05180) | 1134858..1135115 | - | 258 | WP_008103892.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8594.98 Da Isoelectric Point: 9.5023
>T253888 WP_007886938.1 NZ_CP102604:c1131020-1130802 [Pantoea sp. SOD02]
MSNQALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR
MSNQALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14743.36 Da Isoelectric Point: 4.4069
>AT253888 WP_007886936.1 NZ_CP102604:c1131422-1131045 [Pantoea sp. SOD02]
MDEYSPKRHDIAQLKYLCENLFDESMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
MDEYSPKRHDIAQLKYLCENLFDESMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2M9WAL0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | J3DFW0 |