Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1947110..1947747 | Replicon | chromosome |
Accession | NZ_CP102603 | ||
Organism | Bacillus amyloliquefaciens strain MBLB0692 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NUW85_RS09195 | Protein ID | WP_003156187.1 |
Coordinates | 1947110..1947460 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NUW85_RS09200 | Protein ID | WP_003156188.1 |
Coordinates | 1947466..1947747 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUW85_RS09155 (NUW85_09155) | 1942150..1942752 | - | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
NUW85_RS09160 (NUW85_09160) | 1942752..1943540 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NUW85_RS09165 (NUW85_09165) | 1943506..1943988 | - | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
NUW85_RS09170 (NUW85_09170) | 1943985..1944314 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NUW85_RS09175 (NUW85_09175) | 1944378..1945385 | - | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
NUW85_RS09180 (NUW85_09180) | 1945397..1945798 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NUW85_RS09185 (NUW85_09185) | 1945801..1946166 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NUW85_RS09190 (NUW85_09190) | 1946171..1946992 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NUW85_RS09195 (NUW85_09195) | 1947110..1947460 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NUW85_RS09200 (NUW85_09200) | 1947466..1947747 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NUW85_RS09205 (NUW85_09205) | 1947867..1949036 | - | 1170 | WP_003156189.1 | alanine racemase | - |
NUW85_RS09210 (NUW85_09210) | 1949153..1950160 | - | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
NUW85_RS09215 (NUW85_09215) | 1950325..1950690 | - | 366 | WP_014304402.1 | holo-ACP synthase | - |
NUW85_RS09220 (NUW85_09220) | 1950783..1951382 | + | 600 | WP_139885531.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T253885 WP_003156187.1 NZ_CP102603:c1947460-1947110 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|