Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1205694..1206611 | Replicon | chromosome |
Accession | NZ_CP102603 | ||
Organism | Bacillus amyloliquefaciens strain MBLB0692 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NUW85_RS05275 | Protein ID | WP_025851786.1 |
Coordinates | 1205694..1206440 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NUW85_RS05280 | Protein ID | WP_003154807.1 |
Coordinates | 1206441..1206611 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUW85_RS05255 (NUW85_05255) | 1201086..1202036 | - | 951 | WP_015388352.1 | ring-cleaving dioxygenase | - |
NUW85_RS05260 (NUW85_05260) | 1202360..1203676 | + | 1317 | WP_003154801.1 | amino acid permease | - |
NUW85_RS05265 (NUW85_05265) | 1203962..1204579 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NUW85_RS05270 (NUW85_05270) | 1204592..1205590 | + | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NUW85_RS05275 (NUW85_05275) | 1205694..1206440 | + | 747 | WP_025851786.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NUW85_RS05280 (NUW85_05280) | 1206441..1206611 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NUW85_RS05285 (NUW85_05285) | 1206708..1206833 | + | 126 | WP_003154809.1 | hypothetical protein | - |
NUW85_RS05290 (NUW85_05290) | 1206869..1207747 | - | 879 | WP_014304858.1 | N-acetylmuramoyl-L-alanine amidase | - |
NUW85_RS05295 (NUW85_05295) | 1207761..1208024 | - | 264 | WP_003154813.1 | phage holin | - |
NUW85_RS05300 (NUW85_05300) | 1208038..1208301 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NUW85_RS05305 (NUW85_05305) | 1208353..1209114 | - | 762 | WP_058905961.1 | hypothetical protein | - |
NUW85_RS05310 (NUW85_05310) | 1209171..1209368 | - | 198 | WP_003154819.1 | XkdX family protein | - |
NUW85_RS05315 (NUW85_05315) | 1209374..1209745 | - | 372 | WP_014304856.1 | XkdW family protein | - |
NUW85_RS05320 (NUW85_05320) | 1209758..1211380 | - | 1623 | WP_058905960.1 | pyocin knob domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.53 Da Isoelectric Point: 4.7003
>T253884 WP_025851786.1 NZ_CP102603:1205694-1206440 [Bacillus amyloliquefaciens]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|