Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1218647..1219247 | Replicon | chromosome |
| Accession | NZ_CP102602 | ||
| Organism | Thermococcus sp. 813A4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUS69_RS07020 | Protein ID | WP_258085026.1 |
| Coordinates | 1218647..1219012 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NUS69_RS07025 | Protein ID | WP_258085027.1 |
| Coordinates | 1219026..1219247 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUS69_RS07000 | 1214803..1216269 | - | 1467 | WP_258083130.1 | S-layer protein | - |
| NUS69_RS07005 | 1216334..1216873 | + | 540 | WP_258083131.1 | DUF2391 family protein | - |
| NUS69_RS07010 | 1216874..1217908 | + | 1035 | WP_258083132.1 | DUF3226 domain-containing protein | - |
| NUS69_RS07015 | 1217949..1218650 | + | 702 | WP_258085025.1 | HAD family hydrolase | - |
| NUS69_RS07020 | 1218647..1219012 | - | 366 | WP_258085026.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUS69_RS07025 | 1219026..1219247 | - | 222 | WP_258085027.1 | hypothetical protein | Antitoxin |
| NUS69_RS07030 | 1219299..1221626 | - | 2328 | WP_258083133.1 | DNA polymerase | - |
| NUS69_RS07035 | 1221623..1221892 | - | 270 | WP_258083134.1 | hypothetical protein | - |
| NUS69_RS07040 | 1221995..1222426 | - | 432 | WP_258083135.1 | hypothetical protein | - |
| NUS69_RS07045 | 1222426..1223268 | - | 843 | WP_258083136.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13472.61 Da Isoelectric Point: 4.5898
>T253883 WP_258085026.1 NZ_CP102602:c1219012-1218647 [Thermococcus sp. 813A4]
VKVVLQEPGWEEVPTEPHVATLDYALVEGMNAIWKAVRLGELLIEQGKVKVIVLKTLGSSITLFEAHNFFERGLEIGLNE
GITIYDALYIALAEALNAEFLTADEKQYLAAKNYVNAKLLR
VKVVLQEPGWEEVPTEPHVATLDYALVEGMNAIWKAVRLGELLIEQGKVKVIVLKTLGSSITLFEAHNFFERGLEIGLNE
GITIYDALYIALAEALNAEFLTADEKQYLAAKNYVNAKLLR
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|