Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
| Location | 682293..682909 | Replicon | chromosome |
| Accession | NZ_CP102602 | ||
| Organism | Thermococcus sp. 813A4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUS69_RS03930 | Protein ID | WP_258084527.1 |
| Coordinates | 682508..682909 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NUS69_RS03925 | Protein ID | WP_258084526.1 |
| Coordinates | 682293..682520 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUS69_RS03905 | 677544..678545 | - | 1002 | WP_258084523.1 | 2-hydroxyacid dehydrogenase | - |
| NUS69_RS03910 | 678671..680119 | + | 1449 | WP_258084924.1 | proline--tRNA ligase | - |
| NUS69_RS03915 | 680166..680552 | - | 387 | WP_258084524.1 | pyrolysin | - |
| NUS69_RS03920 | 680642..682252 | + | 1611 | WP_258084525.1 | carbamoyltransferase | - |
| NUS69_RS03925 | 682293..682520 | + | 228 | WP_258084526.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NUS69_RS03930 | 682508..682909 | + | 402 | WP_258084527.1 | PIN domain-containing protein | Toxin |
| NUS69_RS03935 | 683056..684225 | + | 1170 | WP_258084925.1 | pyridoxal phosphate-dependent aminotransferase | - |
| NUS69_RS03940 | 684222..684866 | - | 645 | WP_258084528.1 | metallophosphoesterase | - |
| NUS69_RS03945 | 684881..685741 | - | 861 | WP_258084529.1 | M48 family metalloprotease | - |
| NUS69_RS03950 | 685744..686286 | - | 543 | WP_258084530.1 | adenylate kinase family protein | - |
| NUS69_RS03955 | 686426..686641 | + | 216 | WP_055428707.1 | hypothetical protein | - |
| NUS69_RS03960 | 686687..687904 | - | 1218 | WP_258084531.1 | methionine adenosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15505.70 Da Isoelectric Point: 4.7196
>T253882 WP_258084527.1 NZ_CP102602:682508-682909 [Thermococcus sp. 813A4]
MRGVIDTNVLIYDTFEDSEFHGEAERILESLDAWYVPTIVLQEFAWFFRNEGFSADETWEVLRGYLDDPRFRGLNDDSQI
VKKAFEILKVEKLSLSRFNDAMILVHAVEKGVLVTFDSKFRKLAERRGVKVLP
MRGVIDTNVLIYDTFEDSEFHGEAERILESLDAWYVPTIVLQEFAWFFRNEGFSADETWEVLRGYLDDPRFRGLNDDSQI
VKKAFEILKVEKLSLSRFNDAMILVHAVEKGVLVTFDSKFRKLAERRGVKVLP
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|