Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 574139..574745 | Replicon | chromosome |
| Accession | NZ_CP102602 | ||
| Organism | Thermococcus sp. 813A4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUS69_RS03345 | Protein ID | WP_258084426.1 |
| Coordinates | 574139..574537 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NUS69_RS03350 | Protein ID | WP_258084427.1 |
| Coordinates | 574524..574745 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUS69_RS03320 | 569649..570695 | - | 1047 | WP_258084421.1 | Xaa-Pro dipeptidase PepQ | - |
| NUS69_RS03325 | 570820..571482 | + | 663 | WP_258084422.1 | haloacid dehalogenase | - |
| NUS69_RS03330 | 571533..571799 | + | 267 | WP_258084423.1 | 50S ribosomal protein L35ae | - |
| NUS69_RS03335 | 571845..572981 | + | 1137 | WP_258084424.1 | tRNA (guanine(10)-N(2))-dimethyltransferase | - |
| NUS69_RS03340 | 573048..574142 | + | 1095 | WP_258084425.1 | VIT1/CCC1 transporter family protein | - |
| NUS69_RS03345 | 574139..574537 | - | 399 | WP_258084426.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUS69_RS03350 | 574524..574745 | - | 222 | WP_258084427.1 | hypothetical protein | Antitoxin |
| NUS69_RS03355 | 574793..576193 | - | 1401 | WP_258084428.1 | MATE family efflux transporter | - |
| NUS69_RS03360 | 576302..576493 | - | 192 | WP_055428825.1 | 50S ribosomal protein L37e | - |
| NUS69_RS03365 | 576519..576749 | - | 231 | WP_055428824.1 | LSm family protein | - |
| NUS69_RS03370 | 576901..579186 | + | 2286 | WP_258084429.1 | alpha-amylase family glycosyl hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14936.34 Da Isoelectric Point: 4.9888
>T253881 WP_258084426.1 NZ_CP102602:c574537-574139 [Thermococcus sp. 813A4]
VIAIDASVLAKYILLEPGWEQVEELLLKDVISLDYALVEVSNALWKHHVLYGRISREEFERRSRVIDAIPNVVVLENGVE
YLPPARGIALEHKITVYDALYIAQALKYGKLATSDEKQGEIAKKLGIEVFYL
VIAIDASVLAKYILLEPGWEQVEELLLKDVISLDYALVEVSNALWKHHVLYGRISREEFERRSRVIDAIPNVVVLENGVE
YLPPARGIALEHKITVYDALYIAQALKYGKLATSDEKQGEIAKKLGIEVFYL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|