Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 470541..470927 Replicon chromosome
Accession NZ_CP102593
Organism Xanthomonas campestris pv. phormiicola strain CFBP 8444

Toxin (Protein)


Gene name EcnB Uniprot ID A0A0K2ZHE5
Locus tag NRY95_RS01895 Protein ID WP_003469322.1
Coordinates 470793..470927 (+) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID -
Locus tag NRY95_RS01890 Protein ID WP_228318831.1
Coordinates 470541..470693 (+) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRY95_RS01860 (NRY95_01860) 466039..466311 - 273 WP_228318836.1 hypothetical protein -
NRY95_RS01865 (NRY95_01865) 466474..467451 + 978 WP_228318835.1 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA -
NRY95_RS01870 (NRY95_01870) 467448..468188 + 741 WP_228318834.1 type III pantothenate kinase -
NRY95_RS01875 (NRY95_01875) 468198..469055 + 858 WP_228318833.1 SPOR domain-containing protein -
NRY95_RS01885 (NRY95_01885) 469472..470395 + 924 WP_228318832.1 arginase -
NRY95_RS01890 (NRY95_01890) 470541..470693 + 153 WP_228318831.1 entericidin A/B family lipoprotein Antitoxin
NRY95_RS01895 (NRY95_01895) 470793..470927 + 135 WP_003469322.1 entericidin A/B family lipoprotein Toxin
NRY95_RS01900 (NRY95_01900) 471130..471345 + 216 WP_009574162.1 CsbD family protein -
NRY95_RS01905 (NRY95_01905) 471418..472269 - 852 WP_228318830.1 hypothetical protein -
NRY95_RS01910 (NRY95_01910) 472379..473671 + 1293 WP_228318829.1 tryptophan--tRNA ligase -
NRY95_RS01915 (NRY95_01915) 473954..474877 + 924 WP_228318828.1 MBL fold metallo-hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-39)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4604.40 Da        Isoelectric Point: 9.2977

>T253874 WP_003469322.1 NZ_CP102593:470793-470927 [Xanthomonas campestris pv. phormiicola]
MKRTFAWMLLAMFSVGLLSGCNTVAGAGKDVKSAGEKVEDAAKN

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5346.42 Da        Isoelectric Point: 8.1210

>AT253874 WP_228318831.1 NZ_CP102593:470541-470693 [Xanthomonas campestris pv. phormiicola]
MKRLLTLMMLTLFCAGMLTGCNTMAGAGKDMQKAGDKVETKADDCKDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K2ZHE5

Antitoxin

Source ID Structure

References