Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 873115..873783 | Replicon | chromosome |
| Accession | NZ_CP102583 | ||
| Organism | Streptococcus pneumoniae strain D39Mega17545 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B1I7Q0 |
| Locus tag | MOP79_RS04505 | Protein ID | WP_001132285.1 |
| Coordinates | 873115..873294 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | MOP79_RS04510 | Protein ID | WP_000961810.1 |
| Coordinates | 873331..873783 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOP79_RS04475 | 868133..868978 | + | 846 | WP_000819520.1 | carbohydrate ABC transporter permease | - |
| MOP79_RS04480 | 868988..870307 | + | 1320 | WP_000608887.1 | glycoside hydrolase family 32 protein | - |
| MOP79_RS04490 | 870854..872125 | - | 1272 | WP_001113205.1 | replication-associated recombination protein A | - |
| MOP79_RS04495 | 872395..872634 | + | 240 | WP_000818079.1 | hypothetical protein | - |
| MOP79_RS04500 | 872799..872978 | + | 180 | WP_001809903.1 | hypothetical protein | - |
| MOP79_RS04505 | 873115..873294 | + | 180 | WP_001132285.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MOP79_RS04510 | 873331..873783 | + | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MOP79_RS04515 | 874074..874544 | + | 471 | WP_000257105.1 | DUF3013 family protein | - |
| MOP79_RS04520 | 874563..875666 | + | 1104 | WP_000719717.1 | site-2 protease family protein | - |
| MOP79_RS04525 | 875632..876060 | + | 429 | WP_000418176.1 | NUDIX hydrolase | - |
| MOP79_RS04530 | 876198..877148 | + | 951 | WP_000451131.1 | 50S ribosomal protein L11 methyltransferase | - |
| MOP79_RS04535 | 877150..877893 | + | 744 | WP_001188203.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.01 Da Isoelectric Point: 11.2964
>T253869 WP_001132285.1 NZ_CP102583:873115-873294 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT253869 WP_000961810.1 NZ_CP102583:873331-873783 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9HEZ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 5YRZ | |
| AlphaFold DB | G0IC64 |