Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1551631..1552310 | Replicon | chromosome |
| Accession | NZ_CP102580 | ||
| Organism | Acinetobacter baumannii strain A9844 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | NUX13_RS07285 | Protein ID | WP_000838146.1 |
| Coordinates | 1551631..1551813 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | NUX13_RS07290 | Protein ID | WP_000966688.1 |
| Coordinates | 1551906..1552310 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUX13_RS07250 (NUX13_07250) | 1546651..1547094 | + | 444 | WP_002016455.1 | phage tail terminator-like protein | - |
| NUX13_RS07255 (NUX13_07255) | 1547096..1547314 | + | 219 | WP_001277696.1 | hypothetical protein | - |
| NUX13_RS07260 (NUX13_07260) | 1547423..1547944 | + | 522 | WP_000749909.1 | SH3 domain-containing protein | - |
| NUX13_RS07265 (NUX13_07265) | 1548041..1548394 | + | 354 | WP_000064593.1 | hypothetical protein | - |
| NUX13_RS07270 (NUX13_07270) | 1548394..1549749 | + | 1356 | WP_000002415.1 | hypothetical protein | - |
| NUX13_RS07275 (NUX13_07275) | 1549802..1550719 | + | 918 | WP_000094253.1 | phage tail tube protein | - |
| NUX13_RS07280 (NUX13_07280) | 1550790..1551305 | + | 516 | WP_024616020.1 | hypothetical protein | - |
| NUX13_RS07285 (NUX13_07285) | 1551631..1551813 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NUX13_RS07290 (NUX13_07290) | 1551906..1552310 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NUX13_RS07295 (NUX13_07295) | 1552409..1553089 | + | 681 | WP_167790389.1 | hypothetical protein | - |
| NUX13_RS07300 (NUX13_07300) | 1553091..1553354 | + | 264 | WP_001275792.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1514062..1577609 | 63547 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T253867 WP_000838146.1 NZ_CP102580:1551631-1551813 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT253867 WP_000966688.1 NZ_CP102580:1551906-1552310 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|