Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 461402..462055 | Replicon | chromosome |
| Accession | NZ_CP102580 | ||
| Organism | Acinetobacter baumannii strain A9844 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NUX13_RS02240 | Protein ID | WP_000607077.1 |
| Coordinates | 461666..462055 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | NUX13_RS02235 | Protein ID | WP_001288210.1 |
| Coordinates | 461402..461659 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUX13_RS02215 (NUX13_02215) | 456918..457925 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| NUX13_RS02220 (NUX13_02220) | 457944..458321 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| NUX13_RS02225 (NUX13_02225) | 458503..459993 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NUX13_RS02230 (NUX13_02230) | 460042..461214 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| NUX13_RS02235 (NUX13_02235) | 461402..461659 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NUX13_RS02240 (NUX13_02240) | 461666..462055 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
| NUX13_RS02245 (NUX13_02245) | 462825..463910 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| NUX13_RS02250 (NUX13_02250) | 463988..464554 | + | 567 | WP_000651538.1 | rhombosortase | - |
| NUX13_RS02255 (NUX13_02255) | 464742..466937 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T253866 WP_000607077.1 NZ_CP102580:461666-462055 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|