Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 36159..36802 Replicon plasmid p1
Accession NZ_CP102553
Organism Klebsiella pneumoniae strain KPH3

Toxin (Protein)


Gene name vagD Uniprot ID A0A5Q9LNG2
Locus tag NUG48_RS26255 Protein ID WP_048983057.1
Coordinates 36386..36802 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID R4IT22
Locus tag NUG48_RS26250 Protein ID WP_016338373.1
Coordinates 36159..36389 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG48_RS26220 (NUG48_26225) 31491..31991 + 501 WP_001239317.1 hypothetical protein -
NUG48_RS26225 (NUG48_26230) 32141..32782 + 642 WP_001011939.1 type A-2 chloramphenicol O-acetyltransferase CatII -
NUG48_RS26230 (NUG48_26235) 32926..33630 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NUG48_RS26235 (NUG48_26240) 33705..34481 - 777 WP_000015958.1 site-specific integrase -
NUG48_RS26240 (NUG48_26245) 34478..35221 - 744 WP_000129823.1 hypothetical protein -
NUG48_RS26245 (NUG48_26250) 35272..35622 - 351 WP_000493378.1 hypothetical protein -
NUG48_RS26250 (NUG48_26255) 36159..36389 + 231 WP_016338373.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NUG48_RS26255 (NUG48_26260) 36386..36802 + 417 WP_048983057.1 type II toxin-antitoxin system VapC family toxin Toxin
NUG48_RS26260 (NUG48_26265) 36843..37166 - 324 WP_085842301.1 hypothetical protein -
NUG48_RS26265 (NUG48_26270) 37184..37720 - 537 WP_223825639.1 hypothetical protein -
NUG48_RS26270 (NUG48_26275) 38379..39656 + 1278 WP_016338369.1 HlyD family secretion protein -
NUG48_RS26275 (NUG48_26280) 39646..41754 + 2109 WP_016338368.1 peptidase domain-containing ABC transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaSHV-12 / catA2 / tet(D) / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / aac(6')-Ib-cr / blaOXA-1 / dfrA14 - 1..108736 108736


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15022.52 Da        Isoelectric Point: 9.2957

>T253864 WP_048983057.1 NZ_CP102553:36386-36802 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8751.77 Da        Isoelectric Point: 4.3533

>AT253864 WP_016338373.1 NZ_CP102553:36159-36389 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWSSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNG2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Q9LN61

References