Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5201286..5201911 | Replicon | chromosome |
Accession | NZ_CP102552 | ||
Organism | Klebsiella pneumoniae strain KPH3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NUG48_RS25660 | Protein ID | WP_002882817.1 |
Coordinates | 5201286..5201669 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NUG48_RS25665 | Protein ID | WP_004150355.1 |
Coordinates | 5201669..5201911 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG48_RS25645 (NUG48_25650) | 5198652..5199554 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NUG48_RS25650 (NUG48_25655) | 5199551..5200186 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NUG48_RS25655 (NUG48_25660) | 5200183..5201112 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NUG48_RS25660 (NUG48_25665) | 5201286..5201669 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUG48_RS25665 (NUG48_25670) | 5201669..5201911 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NUG48_RS25670 (NUG48_25675) | 5202116..5203033 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
NUG48_RS25675 (NUG48_25680) | 5203047..5203988 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NUG48_RS25680 (NUG48_25685) | 5204033..5204470 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NUG48_RS25685 (NUG48_25690) | 5204467..5205327 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
NUG48_RS25690 (NUG48_25695) | 5205321..5205920 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T253863 WP_002882817.1 NZ_CP102552:c5201669-5201286 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |