Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4002740..4003359 Replicon chromosome
Accession NZ_CP102552
Organism Klebsiella pneumoniae strain KPH3

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NUG48_RS19910 Protein ID WP_002892050.1
Coordinates 4003141..4003359 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NUG48_RS19905 Protein ID WP_002892066.1
Coordinates 4002740..4003114 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG48_RS19895 (NUG48_19900) 3997892..3999085 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NUG48_RS19900 (NUG48_19905) 3999108..4002254 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NUG48_RS19905 (NUG48_19910) 4002740..4003114 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NUG48_RS19910 (NUG48_19915) 4003141..4003359 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NUG48_RS19915 (NUG48_19920) 4003518..4004084 + 567 WP_002892030.1 maltose O-acetyltransferase -
NUG48_RS19920 (NUG48_19925) 4004056..4004196 - 141 WP_004147370.1 hypothetical protein -
NUG48_RS19925 (NUG48_19930) 4004217..4004687 + 471 WP_002892026.1 YlaC family protein -
NUG48_RS19930 (NUG48_19935) 4004662..4006113 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NUG48_RS19935 (NUG48_19940) 4006214..4006912 + 699 WP_002892021.1 GNAT family protein -
NUG48_RS19940 (NUG48_19945) 4006909..4007049 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NUG48_RS19945 (NUG48_19950) 4007049..4007312 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253859 WP_002892050.1 NZ_CP102552:4003141-4003359 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253859 WP_002892066.1 NZ_CP102552:4002740-4003114 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References