Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 116594..117195 | Replicon | plasmid p2 |
| Accession | NZ_CP102548 | ||
| Organism | Klebsiella pneumoniae strain KPH1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | NUG47_RS27585 | Protein ID | WP_001216034.1 |
| Coordinates | 116815..117195 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NUG47_RS27580 | Protein ID | WP_001190712.1 |
| Coordinates | 116594..116815 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG47_RS27560 (112810) | 112810..114081 | - | 1272 | WP_048266692.1 | restriction endonuclease subunit S | - |
| NUG47_RS27565 (114078) | 114078..114368 | - | 291 | Protein_138 | SAM-dependent methyltransferase | - |
| NUG47_RS27570 (114424) | 114424..115121 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| NUG47_RS27575 (115116) | 115116..116411 | - | 1296 | Protein_140 | type I restriction-modification system subunit M | - |
| NUG47_RS27580 (116594) | 116594..116815 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NUG47_RS27585 (116815) | 116815..117195 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NUG47_RS27590 (117200) | 117200..117379 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| NUG47_RS27595 (117407) | 117407..117685 | + | 279 | Protein_144 | pdcB | - |
| NUG47_RS27600 (117690) | 117690..118103 | + | 414 | Protein_145 | integrase core domain-containing protein | - |
| NUG47_RS27605 (118053) | 118053..118388 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| NUG47_RS27610 (118598) | 118598..119578 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| NUG47_RS27615 (119822) | 119822..121225 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| NUG47_RS27620 (121212) | 121212..122144 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-1 | - | 1..125297 | 125297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T253849 WP_001216034.1 NZ_CP102548:116815-117195 [Klebsiella pneumoniae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |