Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 116594..117195 Replicon plasmid p2
Accession NZ_CP102548
Organism Klebsiella pneumoniae strain KPH1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NUG47_RS27585 Protein ID WP_001216034.1
Coordinates 116815..117195 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NUG47_RS27580 Protein ID WP_001190712.1
Coordinates 116594..116815 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG47_RS27560 (112810) 112810..114081 - 1272 WP_048266692.1 restriction endonuclease subunit S -
NUG47_RS27565 (114078) 114078..114368 - 291 Protein_138 SAM-dependent methyltransferase -
NUG47_RS27570 (114424) 114424..115121 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
NUG47_RS27575 (115116) 115116..116411 - 1296 Protein_140 type I restriction-modification system subunit M -
NUG47_RS27580 (116594) 116594..116815 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NUG47_RS27585 (116815) 116815..117195 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NUG47_RS27590 (117200) 117200..117379 + 180 WP_001513661.1 hypothetical protein -
NUG47_RS27595 (117407) 117407..117685 + 279 Protein_144 pdcB -
NUG47_RS27600 (117690) 117690..118103 + 414 Protein_145 integrase core domain-containing protein -
NUG47_RS27605 (118053) 118053..118388 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
NUG47_RS27610 (118598) 118598..119578 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
NUG47_RS27615 (119822) 119822..121225 + 1404 WP_001373486.1 S-methylmethionine permease -
NUG47_RS27620 (121212) 121212..122144 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-1 - 1..125297 125297


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T253849 WP_001216034.1 NZ_CP102548:116815-117195 [Klebsiella pneumoniae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT253849 WP_001190712.1 NZ_CP102548:116594-116815 [Klebsiella pneumoniae]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References