Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 103185..103828 | Replicon | plasmid p2 |
Accession | NZ_CP102548 | ||
Organism | Klebsiella pneumoniae strain KPH1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | NUG47_RS27530 | Protein ID | WP_001044768.1 |
Coordinates | 103412..103828 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | NUG47_RS27525 | Protein ID | WP_001261287.1 |
Coordinates | 103185..103415 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG47_RS27515 (98363) | 98363..99496 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
NUG47_RS27520 (99759) | 99759..102878 | - | 3120 | WP_001553851.1 | hypothetical protein | - |
NUG47_RS27525 (103185) | 103185..103415 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NUG47_RS27530 (103412) | 103412..103828 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUG47_RS27535 (103990) | 103990..106128 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
NUG47_RS27540 (106593) | 106593..107588 | + | 996 | WP_000246636.1 | hypothetical protein | - |
NUG47_RS27545 (107631) | 107631..108524 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-1 | - | 1..125297 | 125297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T253848 WP_001044768.1 NZ_CP102548:103412-103828 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |