Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 96706..97231 | Replicon | plasmid p2 |
| Accession | NZ_CP102548 | ||
| Organism | Klebsiella pneumoniae strain KPH1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NUG47_RS27495 | Protein ID | WP_001159868.1 |
| Coordinates | 96706..97011 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NUG47_RS27500 | Protein ID | WP_000813634.1 |
| Coordinates | 97013..97231 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG47_RS27480 (92616) | 92616..93782 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| NUG47_RS27485 (94370) | 94370..95125 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| NUG47_RS27490 (95899) | 95899..96705 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| NUG47_RS27495 (96706) | 96706..97011 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NUG47_RS27500 (97013) | 97013..97231 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NUG47_RS27505 (97865) | 97865..98062 | + | 198 | WP_000215657.1 | hypothetical protein | - |
| NUG47_RS27510 (98059) | 98059..98343 | - | 285 | WP_000642771.1 | hypothetical protein | - |
| NUG47_RS27515 (98363) | 98363..99496 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-1 | - | 1..125297 | 125297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T253847 WP_001159868.1 NZ_CP102548:c97011-96706 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|